References to Work on Conus Toxins
(A-Z, annotated)
(See also selected references of B.M.
Olivera and colleagues on Conotoxins, some books on cone
shells, a Bibliography of Conus references (1) ; (2); "What's New in 1999", "2000", "2001", or search the database using the NCBI Entrez Browser).
See also - Marco Bettocchi's Conus Bibliography. Link here for a list of Journals on the web .
Link here for a List of earlier Books / Journal Articles on Venomous Cones
Latest addition :
Miljanich, G.P. (2004) Ziconotide: neuronal calcium channel blocker for treating severe chronic pain. Curr Med Chem. 2004 Dec;11(23):3029-3040.
Elan Pharmaceuticals, Inc., 7475 Lusk Boulevard, San Diego, CA 92121, USA. george.miljanich@elan.com
Abstract: Ziconotide (PRIALT) is a neuroactive peptide in the final stages of clinical development as a novel non-opioid treatment for severe chronic pain. It is the synthetic equivalent of omega-MVIIA, a component of the venom of the marine snail, Conus magus. The mechanism of action underlying ziconotide's therapeutic profile derives from its potent and selective blockade of neuronal N-type voltage-sensitive calcium channels (N-VSCCs). Direct blockade of N-VSCCs inhibits the activity of a subset of neurons, including pain-sensing primary nociceptors. This mechanism of action distinguishes ziconotide from all other analgesics, including opioid analgesics. In fact, ziconotide is potently anti-nociceptive in animal models of pain in which morphine exhibits poor anti-nociceptive activity. Moreover, in contrast to opiates, tolerance to ziconotide is not observed. Clinical studies of ziconotide in more than 2,000 patients reveal important correlations to ziconotide's non-clinical pharmacology. For example, ziconotide provides significant pain relief to severe chronic pain sufferers who have failed to obtain relief from opiate therapy and no evidence of tolerance to ziconotide is seen in these patients. Contingent on regulatory approval, ziconotide will be the first in a new class of neurological drugs: the N-type calcium channel blockers, or NCCBs. Its novel mechanism of action as a non-opioid analgesic suggests ziconotide has the potential to play a valuable role in treatment regimens for severe chronic pain. If approved for clinical use, ziconotide will further validate the neuroactive venom peptides as a source of new and useful medicines.
Livett, B.G., Gayler, K.R., Khalil, Z. (2004) Drugs from the sea: conopeptides as potential therapeutics. Curr Med Chem. 11: 1715-1723.
Department of Biochemistry and Molecular Biology, University of Melbourne, Parkville, Victoria, 3010, Australia.
Abstract:Marine cone snails from the genus Conus are estimated to consist of up to 700 species. These predatory molluscs have devised an efficient venom apparatus that allows them to successfully capture polychaete worms, other molluscs or in some cases fish as their primary food sources. The toxic venom used by the cone shells contains up to 50 different peptides that selectively inhibit the function of ion channels involved in the transmission of nerve signals in animals. Each of the 700 Conus species contains a unique set of peptides in their venom. Across the genus Conus, the conotoxins represent an extensive array of ion channel blockers each showing a high degree of selectivity for particular types of channels. We have undertaken a study of the conotoxins from Australian species of Conus that have the capacity to inhibit specifically the nicotinic acetylcholine receptors in higher animals. These conotoxins have been identified by mass spectroscopy and their peptide sequences in some cases deduced by the application of modern molecular biology to the RNA extracted from venom ducts. The molecular biological approach has proven more powerful than earlier protein/peptide based technique tor the detection of novel conotoxins [1,2]. Novel conotoxins detected in this way have been further screened for their abilities to modify the responses of tissues to pain stimuli as a first step in describing their potential as lead compounds for novel drugs. This review describes the progress made by several research groups to characterise the properties of conopeptides and to use them as drug leads for the development of novel therapeutics for the treatment of a range of neurological conditions.
Alonso D., Khalil Z., Satkunanathan N. and Livett B.G. (2003) Drugs From the Sea: Conotoxins as Drug Leads for Neuropathic Pain and Other Neurological Conditions. Mini Reviews in Medicinal Chemistry 3: 785-787
Abstract:The oceans are a source of a large group of structurally unique natural products that are mainly found in invertebrates such as sponges, tunicates, bryozoans, and molluscs. It is interesting to note that the majority of marine compounds currently in clinical trials or under preclinical evaluation are produced by these species rather than as secondary metabolites by marine algae [1]. Through the combined efforts of marine natural products chemists and pharmacologists a number of promising compounds have been identified that are either already at advanced stages of clinical trials such as the new anti-cancer drug marine alkaloid ecteinascidin 743 [2], or have been selected as promising candidates for extended preclinical evaluation [3]. This is the case for conotoxins, (Table 1) where a number of conopeptides are currently being developed as analgesics for the treatment of neuropathic pain.
PMID: 14529519 [PubMed - in process]
Aneiros, A. and Garateix, A.(2004) Bioactive peptides from marine sources: pharmacological properties and isolation procedures. J Chromatogr B Analyt Technol Biomed Life Sci. 803: 41-53.
Centre of Marine Bioactive Substances (CEBIMAR), Ministry of Science Technology and Environment, PO Box 10600, Loma y 37, Alturas del Vedado, Ciudad, Habana, Cuba. cebimar@infomed.sld.cu Marine organisms represent a valuable source of new compounds. The biodiversity of the marine environment and the associated chemical diversity constitute a practically unlimited resource of new active substances in the field of the development of bioactive products. In this paper, the molecular diversity of different marine peptides is described as well as information about their biological properties and mechanisms of action is provided. Moreover, a short review about isolation procedures of selected bioactive marine peptides is offered. Novel peptides from sponges, ascidians, mollusks, sea anemones and seaweeds are presented in association with their pharmacological properties and obtainment methods.
ARGONAUTA Publishes Cone Articles
Cone collectors are having a field day! Now, along with the new Manual of the Conidae, Vol. 1, everything's coming up cones! The Argonauta, quarterly journal of the International Association of Malacology (A.M.I.), has three cone articles in recent issues. E. Rolán and G. Raybaudi Massila have "Spawning and Development of Mediterranean Conus: aquarium observations" in the Vol. IX (1-6) June 1995 issue, and the whole of Vol. VIII is a Conus number. December 1994 (7-12) contains D. Röckel's Conus: tuberculosus Tomlin, 1937, a disregarded Conus species" and the 61-page extensive "New Investigation on the radular teeth of Conus -- Part II" by Rolán and Massila, heavily illustrated with full-page color plates of Conus. (Part I was published in Vol VIII, No. 1-6, along with W. Korn's "An attempt in SEM Studies of Conus Egg Capsules.") For more information about these articles or for a subscription ($50.00 per year to U.S.), write Roberto Ubaldi, President, A.M.I., Vicolo del Fosso del Fontanile, 20, 1125 Acilia, Roma, Italy.
ALPHABETICAL LISTING
Abbott, (1967). Venom apparatus and geographical distribution of Conus gloriamaris. 8pp., 4figs.
Adams, M.E. and B.M. Olivera (1994) Neurotoxins: Overview of an emerging research technology. TINS 17: 151-155.
Dept of Entomology, University of California, Riverside 92521.
Abstract: Neurotoxins have highly specific actions on molecular targets, and thus offer an effective means of characterizing the growing number of identified ion channels and receptors in the nervous system. This article and the Neurotoxins Supplement accompanying this issue of TINS provide a convenient reference source to facilitate the use of toxins as selective, diagnostic ligands in research. However, while many toxins exert potent actions on target receptors, it must be emphasized that their effects can be complex, and certain general pitfalls often become apparent. Some examples will be given illustrating these complexities and their impact on experimental interpretation. In addition, the potential for the purposeful creation of new 'designer' toxins using molecular cloning will also be addressed.
David J. Adams 1 *, Paul F. Alewood 2, David J. Craik 2, Roger D. Drinkwater 3, Richard J. Lewis 1 2 (1999) Conotoxins and their potential pharmaceutical applications Dev. Res. 46:219-234, 1999. .
1Department of Physiology and Pharmacology, University of Queensland, Brisbane, QLD, Australia 2Centre for Drug Design and Development, University of Queensland, Brisbane, QLD, Australia 3CSIRO, Gehrmann Laboratories, University of Queensland, Brisbane, QLD, Australia
Abstract: The neurotoxins isolated from cone shell venoms are a diverse group of small, disulfide-rich peptides. Most of the active peptides isolated to date have been shown to specifically target various components of neural transmission, and have generally demonstrated high specificities for ion channel and receptor types and subtypes. The specificity of conotoxins is one of the attributes that make them valuable diagnostic tools in the characterisation of neural pathways, as therapeutic agents in medicine, and potentially as biodegradable toxic agents in agroveterinary applications. The number of novel, active peptides within the numerous Conus species is considered to be enormous. Currently, however, relatively few peptides have been characterised. In this article, we review current research on conotoxins with a focus on drug potential being developed at the University of Queensland, Australia. Drug © 1999 Wiley-Liss, Inc.
Adams, M.E., Myers, R.A., Imperial, J.S. and Olivera, B.M. (1993) Toxityping rat brain calcium channels with omega-toxins from spider and cone snail venoms. Biochemistry, 32: 12566-12571. .
Abstract: The synthesis of (I) omega-agatoxins and (I) omega-conotoxins and their use as radioligands to distinguish putatitive binding sites on calcium channels are described. Omega-toxins such as omega-Aga-IIIA and omega-Aga-IVA prepared from spider venom and omega-CTX-MVIIC prepared from snail venom, are high affinity receptor binders in rat brain. These ligands show high specificity for calcium channels.
Akiyama T, Yamazaki T, Mori H, Sunagawa K (2004) Effects of Ca2+ channel antagonists on acetylcholine and catecholamine releases in the in vivo rat adrenal medulla. . Am J Physiol Regul Integr Comp Physiol. Mar 18 [Epub ahead of print].
Drs. Akiyama , Yamazaki, Mori, and Sunagawa from the Department of Cardiac Physiology, National Cardiovascular Center Research Institute, Suita, Osaka, Japan, have used conotoxin GVIA and MVIIC to provide evidence for the differential involvement of calcium channels in the release of adrenaline and noradrenaline from rat chromaffin cells in-vivo.
Abstract: To elucidate the types of voltage-dependent Ca(2+) channels controlling acetylcholine and catecholamine releases in the in vivo adrenal medulla, we implanted microdialysis probes in the left adrenal medulla of anesthetized rats and investigated the effects of Ca(2+) channel antagonists on acetylcholine, norepinephrine, and epinephrine releases induced by nerve stimulation. The dialysis probes were perfused with Ringer's solution containing a cholinesterase inhibitor, neostigmine. The left splanchnic nerves were electrically stimulated at 2 and 4 Hz before and after intravenous administration of Ca(2+) channel antagonists. omega-Conotoxin GVIA (an N-type Ca(2+) channel antagonist, 10 micro g/kg) inhibited acetylcholine release at 2 and 4 Hz by about 40%, norepinephrine release at 4 Hz by about 50%, and epinephrine release at 2 and 4 Hz by about 45%. A 5-fold higher dose of omega-conotoxin GVIA (50 micro g/kg) did not further inhibit these releases. omega-Conotoxin MVIIC (a P/Q-type Ca(2+) channel antagonist, 50 micro g/kg) inhibited acetylcholine and epinephrine releases at 4 Hz by about 30%. Combined omega-conotoxin GVIA (50 micro g/kg) and MVIIC (250 micro g/kg) inhibited acetylcholine release at 2 and 4 Hz by about 70%, norepinephrine and epinephrine releases at 2 and 4 Hz by about 80%. Nifedipine (an L-type Ca(2+) channel antagonist, 300 and 900 micro g/kg) did not change acetylcholine release at 2 and 4 Hz, but nifedipine (300 micro g/kg) inhibited epinephrine release at 4 Hz by 20% and nifedipine (900 micro g/kg) inhibited norepinephrine and epinephrine releases at 4 Hz by 30%. In conclusion, both N- and P/Q-type Ca(2+) channels control acetylcholine release on pre-ganglionic splanchnic nerve endings while L-type Ca(2+) channels do not. L-type Ca(2+) channels are involved in norepinephrine and epinephrine releases on chromaffin cells.
Alam, M., and Thomson, R.H. (1997) Handbook of natural products from marine invertebrates, Part 1 Phylum Mollusca.
by Maktoob Alam and Ronald H. Thomson
ISBN 90-5702-253-2 Subtitle (phylum Mollusca) Publisher Harwood Academic Publishers, Amsterdam, 1997
Subject Marine invertebrates -- Handbooks, manuals, etc. Publication Date 1997. Illustrations Yes
Abstract: A listing of hundreds of compounds derived from members of the phyllum Mollusca. Includes terpenes, polypropionates, aromatic and aliphatic nitrogenous compounds, polypeptides, macrolides, prostaglandins, and sterols. Each entry includes a molecular formula, the scientific and trivial name (if any) of the compound, the source mollusk, bioactivity information, reference sources, and more. The review copy contained two tables of contents but not the preface that appears in the table of contents. Entries are indexed by source, name, and molecular formula.
UniM, Chem, 572.3613,MAKT
Albillos A, García AG, Olivera BM, Gandía L (1996) Re-evaluation of the P/Q Ca 2+ channel components of the Ba 2+ currents in bovine chromaffin cells superfused with solutions containing low and high Ba 2+ concentrations. Pflügers Arch 432 10301038
Key words: Calcium channels, Chromaffin cells, w-agatoxin IVA, w-Conotoxin GVIA, w-Conotoxin MVIIC, Furnidipine.
Alcala, A.C. (1983) Recent cases of crab, cone shell, and fish intoxication on Southern Negros Island, Philippines. Toxicon, suppl. 3, 1.
Alexander,C.G. (1971a). The osphradium of Conus flavidus.
Marine Biology. 6 (3). 236-240
Alexander,C.G. (1973). The neuroanatomy of the osphradium in Conus
flavidus Lamarck. The Veliger. 16 (1). 68-71
Alexander,C.G. & Weldon,M.W. (1975). The fine structure of the
osphradial leaflets in Conus flavidus Marine Biology, 33: 247-254
Alonso D., Khalil Z., Satkunanathan N. and Livett B.G. (2003) Drugs From the Sea: Conotoxins as Drug Leads for Neuropathic Pain and Other Neurological Conditions. Mini Reviews in Medicinal Chemistry 3: 785-787
Abstract:The oceans are a source of a large group of structurally unique natural products that are mainly found in invertebrates such as sponges, tunicates, bryozoans, and molluscs. It is interesting to note that the majority of marine compounds currently in clinical trials or under preclinical evaluation are produced by these species rather than as secondary metabolites by marine algae [1]. Through the combined efforts of marine natural products chemists and pharmacologists a number of promising compounds have been identified that are either already at advanced stages of clinical trials such as the new anti-cancer drug marine alkaloid ecteinascidin 743 [2], or have been selected as promising candidates for extended preclinical evaluation [3]. This is the case for conotoxins, (Table 1) where a number of conopeptides are currently being developed as analgesics for the treatment of neuropathic pain.
PMID: 14529519 [PubMed - in process]
Azuma, (1973). On the radulae of some remarkable gastropods from off Kirimezaki, Kii Peninsula, Japan, with the description of a new cone shell. 8pp., 1pl., 11figs., in Japanese & English, with message from author. Euro 1.50
Baell JB, Harvey AJ, Norton RS. (2002) Design and synthesis of type-III mimetics of ShK toxin. J Comput Aided Mol Des. 16 : 245-62.
Abstract:ShK toxin is a structurally defined, 35-residue polypeptide which blocks the voltage-gated Kv1.3 potassium channel in T-lymphocytes and has been identified as a possible immunosuppressant. Our interest lies in the rational design and synthesis of type-III mimetics of protein and polypeptide structure and function. ShK toxin is a challenging target for mimetic design as its binding epitope consists of relatively weakly binding residues, some of which are discontinuous. We discuss here our investigations into the design and synthesis of 1st generation, small molecule mimetics of ShK toxin and highlight any principles relevant to the generic design of type-III mimetics of continuous and discontinuous binding epitopes. We complement our approach with attempted pharmacophore-based database mining.
Bandyopadhyay, P.K., Colledge, C.J., Walker, C.S., Zhou, L., Hillyard, D.R., Olivera, B.M. (1998) Conantokin-G precursor and its role in g -carboxylation by a vitamin K-dependent carboxylase from a Conus snail. JBC 273: 5447-5450.
BALL, 2002. Foregut ontogeny of the Neogastropoda: comparison of
development in Nucella lapillus & Conus anemone. 28pp., 19figs., 2tabs..
Bandel, 1984. The radulae of Caribbean & other Mesogastropoda &
Neogastropoda. 188pp., 22pls., 346figs., .
Bandel & al., 1977. On Conus mediterraneus & C. guinaicus. 13pp., 31figs.,
Dutch summ., with message from the 2nd author. Euro 1.95
Banos J.E., Sanchez G., Berrendero F. and Maldonado R. (2003) Neuropathic Pain: Some Clues for Future Drug Treatments.
Mini Reviews in Medicinal Chemistry 3: 719-727
Abstract:Neuropathic pain is still far from being adequately dealt with. Under this name, several clinical entities have been considered and most of them only share several painful ailments. At present, the available treatments can only alleviate the pain of roughly half of the patients, and their effectiveness is often limited by the appearance of the intolerable side effects. In this review, we will consider the pathophysiology of neuropathic pain to understand the basis of pharmacological treatments that are currently being investigated. Some examples of these drugs will also be considered.
PMID: 14529513 [PubMed - in process]
Barabino, B., Vailati, S., Moretti, M., McIntosh, J.M., Longhi, R., Clementi, F. and Gotti, C. (2001) "An alpha 4beta nicotinic receptor subtype is present in chick retina. Identification, characterization and pharmacological comparison with the transfected alpha 4beta 4 and alpha 6beta 4 subtypes". Mol. Pharmacol. 59: (6) p. 1410-1417.
Barinaga, M. (1990). Science digests the secrets of voracious killer snails. Science.249: 250-251. [Extract: There are more than 500 species of cone shells, each with their own distinctive toxin. Scientists have found that these toxins are ideal substances with which to investigate the properties of nerve cell receptors and ion channels. Most exciting is the hope that cone-shell toxins can be used to unravel the properties of the NMDA receptor, which is implicated in learning and memory in humans (Barinaga, 1990)].
BARTSCH & al., 1943. New cones from the Hawaiian Isls. 4pp. Euro 0.70
Basus, V.J., Nadasdi, L., Ramachandran, J. and Miljanich, G.P. (1995) Solution structure of omega-conotoxin MVIIA using 2D NMR spectroscopy.FEBS Letters, 370: 163-170..
Abstract: The solution structure of omega-conotoxin MVIIA (SNX-111), a peptide toxin from the fish hunting cone snail Conus magus and a high-affinity blocker of N-type calcium channels, was determined by 2D NMR spectroscopy. The backbones of the best 44 structures match with an average pairwise RMSD of 0.59 angstroms. The structures contain a short segment of triple-stranded beta-sheet involving residues 6-8, 20-21, and 24-25. The structure of this toxin is very similar to that of omega-conotoxin GVIA with which is has only 40% sequence homology, but very similar calcium channel binding affinity and selectivity.
BAYER, F.M. & G.L. VOSS (EDS), 1971.
Studies in Tropical American Mollusks; [6], 236 p., 207 figs, cloth (library stamp). Contains 4 papers: Cephalopods Collected in the Gulf of Panama / Mollusks from the Gulf of Panama / The Conidae of the Pilssbury Expedition / New and Unusual Mollusks Collected.
BENTHEM JUTTING, T. VAN, 1932-1960.Sammlung nichtmariner Mollusken aus dem niederschlagsarmen Gebiete
Nordost-Brasiliens. ML03255 € 22,00
Collection of 5 papers on marine molluscs; Includes two papers on shells from prehistoric kitchen-middens, one on Conus nobilis, one on Quartenary shells from Venezuela, and one on malacological research in the Malay Archipelago.
Bhakuni, D.S. (1995) The toxic metabolites of marine organisms. J.
Scientific & Industrial Research. 54 (12): 702-716.
[Abstract:
The toxic metabolites of diatoms, blue-green algae,
sea-cucumber, sponges, coelenterate, and tunicates have been reviewed. The origin,
biosynthesis, mechanism of action of saxitoxin, tetrodotoxin, brevetoxins, palytoxin and
their derivatives, ciguatoxins, maitotoxin, diarrhetic shellfish toxins, pectenotoxins,
yessotoxin, neosuruatoxin, and prosurugatoxin have been discussed. Cone shell and
sea snake venoms have also been reviewed]. [References: 139]
Dunlap ME, Bibevski S, Rosenberry TL, Ernsberger P. (2003) Mechanisms of altered vagal control in heart failure: influence of muscarinic receptors and acetylcholinesterase activity. Am J Physiol Heart Circ Physiol. 285: H1632-40.
Bibevski S, Zhou Y, McIntosh JM, Zigmond RE, Dunlap ME. (2000) Functional nicotinic acetylcholine receptors that mediate ganglionic transmission in cardiac parasympathetic neurons. J Neurosci. 20: 5076-82.
Abstract: Nicotinic acetylcholine receptors (nAChRs) mediate ganglionic transmission in the peripheral autonomic nervous system in mammals. Functional neuronal nAChRs have been shown to assemble from a combination of alpha and beta subunits, including alpha3, alpha5, alpha7, beta2, and beta4 in RNA-injected oocytes, but the subunit composition of functional neuronal nAChRs in vivo in mammals remains unknown. We examined the subunit composition of functional nAChRs in the intracardiac parasympathetic ganglion in a physiologically intact system in vivo. We report here that localized perfusion of the canine intracardiac ganglion in situ with an antagonist specific for nAChRs containing an alpha3/beta2 subunit interface (alpha-conotoxin MII 100-200 nm) resulted in reversible attenuation of the sinus cycle length (SCL) response by approximately 70% to electrical stimulation of the preganglionic vagus nerve. Perfusion with antagonist specific for receptors containing an alpha3/beta4 subunit interface (alpha-conotoxin AuIB 1 micrometer) resulted in attenuation in SCL responses (approximately 20%) compared with baseline when applied by itself, but not in animals pretreated with alpha-conotoxin MII. Perfusion of the ganglion with alpha-bungarotoxin (1 micrometer, which blocks alpha7 receptors) caused a reduction in SCL response by approximately 30% compared with baseline when perfused on its own and when added after blockade with MII and AuIB. Perfusion with hexamethonium bromide resulted in complete blockade of ganglionic transmission, confirming total perfusion of the ganglion and the nicotinic nature of ganglionic transmission at this synapse. Immunohistochemistry using monoclonal antibodies against specific nicotinic subunits confirmed the presence of alpha3, alpha7, beta2, and beta4 subunits. We conclude that functional ganglionic transmission in the canine intracardiac ganglion is mediated primarily by receptors containing an alpha3/beta2 subunit interface, with a smaller contribution by receptors containing alpha7 nAChRs. Despite the presence of beta4 subunits in functional channels, a contribution of a distinct alpha3/beta4 receptor population that does not include an alpha3/beta2 subunit interface was less clear.
Bibevski S, Dunlap ME. (1999) Ganglionic mechanisms contribute to diminished vagal control in heart failure. Circulation. 99:2958-63.
Bingham, J-P., Jones, A., Lewis, R.J., Andrews, P.R. and Alewood, P.F. (1996) Conus venom peptides (Conopeptides) Inter-Species, intra-species and within individual variation revealed by ionspray mass spectrometry. Chapter 2, In Lazarovici P, Spira ME, Zlotkin, E, (Eds), Biochemical Aspects of Marine Pharmacology, Alaken Inc. Fort Collins Colorado, Proceedings of Eilat Conference on Interuniversity Institute of Marine Sciences Eilat, May, 1995, pp. 13-27.
[Abstract: This manuscript provides an overview of the mass spectrometric studies of cone shell venoms that the Alewood group is currently conducting as part of a search for new bioactive conopeptides and, ultimately, novel peptidomimetic drugs. These studies reveal surprising variability in the molecular composition of Conus toxins both between and within species, and even within individual specimens].
Boccaccio, A., Conti, F., Olivera, B.M. and Terlau, H. (2004) Binding of {kappa}-Conotoxin PVIIA to Shaker K+ Channels Reveals Different K+ and Rb+ Occupancies within the Ion Channel Pore. J. Gen. Physiol. 124: 71-81.
BOZZETTI, 2004. Conus solangeae dal Madagascar Meridionale. 2pp., 1tab.,
7col.figs. MALACOLOGICA MOSTRA MONDIALE, 43 [2004]. 16ppEuro 10.0
BOZZETTI, 2005. Conus giorossii sp.n. da Flores, Indonesia. 3pp.,
Brown, M,A., Hambe, B., Furie, B., Furie, B.C., Stenflo, J. and Stenberg, L.M.(2002) Detection of vitamin K-dependent proteins in venoms with a monoclonal antibody specific for gamma-carboxyglutamic acid. Toxicon, 40: 447-454. .
Abstract: gamma-Carboxyglutamic acid (Gla) is an unusual amino acid that is synthesized post-translationally from glutamate in a vitamin K-dependent reaction. The dicarboxylic side chain of Gla chelates Ca2+, a property important for the biological activity of vitamin K-dependent proteins. To date, Gla-containing polypeptides have been identified in venom from two groups of organisms: elapid snakes, and snails of the genus Conus. In certain elapid snakes, a gamma-carboxylated coagulation factor Xa-like protein is a component of the venom whereas cone snails utilize Gla in a range of peptide neurotoxins. Using a monoclonal antibody that specifically recognizes Gla residues, venom samples from various organisms were screened by western blotting and immunofluorescence assays. Amino acid analyses were also performed on most samples. A survey of 21 snake species from 12 genera detected gamma-carboxylated polypeptides only in venom of snakes from the elapid subfamily Acanthophiinae. Gla-containing polypeptides were also observed in cone snail venom but not in venom or toxic salivary secretions from several other organisms. The Gla-specific antibody used here provides a simple immunochemical means to detect gamma-carboxylated polypeptides in venom and may allow new species to be identified that utilize Gla in the biosynthesis of toxic polypeptides.
Broxton, N.M., Down, J.G., Gehrmann, J., Alewood, P.F., Satchell, D.G. and Livett, B.G.
"Alpha-conotoxin ImI inhibits the alpha-bungarotoxin-resistant nicotinic response in bovine adrenal chromaffin cells".
J. Neurochem. 72:1656-1662 (1999).
Abstract:
Reference concerning the selectivity of conotoxin ImI from Conus imperialis for the neuronal-type nicotinic receptor.
.
Buccafusco, J.J.(2004) Neuronal Nicotinic Receptor Subtypes: DEFINING THERAPEUTIC TARGETS. Mol Interv. 4:285-295.
Alzheimer's Research Center, Medical College of Georgia, 1120 15 Street,
Augusta, Georgia 30912-2300.
Abstract:Humans have appreciated the beneficial properties of the tobacco plant for thousands of years. These effects include alertness, reduced anxiety, muscle relaxation, and analgesia. Yet it has been less than two decades since the central actions of nicotine have been examined in earnest for potential therapeutic applications. In fact, the cholinergic systems, in comparison to other neurotransmitter systems of the body, have been relatively poorly exploited in terms of therapeutic agents, and the muscarinic cholinergic systems have been relegated mainly to the treatment of gastrointestinal disorders and glaucoma; for the nicotinic system, antagonists are used to induce muscle paralysis during certain surgical procedures. For both families of cholinergic receptors, widespread exploitation in terms of therapeutics has been limited by significant side effect profiles associated with available cholinergic drugs.
Bulaj, G. Representative Publications
- Buczek O, Olivera BM, Bulaj G "Propeptide Does not Act as an Intramolecular Chaperone, but Facilitates Protein Disulfide Isomerase - Assisted Folding of a Conotoxin Precursor" Biochemistry - in press
- Bulaj G, Buczek O, Goodsell I, Jimenez EC, Kranski J, Nielsen JS, Garrett JE, Olivera BM (2003) "Efficient Oxidative Folding of Conotoxins and the Radiation of Venomous Cone Snails" Proc Natl Acad Sci USA, 100, Suppl 2, 14562-14568.
Bulaj G, Buczek O, Goodsell I, Jimenez EC, Kranski J, Nielsen JS, Garrett JE, Olivera BM. (2003)Efficient oxidative folding of conotoxins and the radiation of venomous cone snails. Proc Natl Acad Sci U S A. 100 Suppl 2:14562-14568.
Department of Biology, University of Utah, Salt Lake City, UT 84112, USA.
Abstract: The 500 different species of venomous cone snails (genus Conus) use small, highly structured peptides (conotoxins) for interacting with prey, predators, and competitors. These peptides are produced by translating mRNA from many genes belonging to only a few gene superfamilies. Each translation product is processed to yield a great diversity of different mature toxin peptides (approximately 50,000-100,000), most of which are 12-30 aa in length with two to three disulfide crosslinks. In vitro, forming the biologically relevant disulfide configuration is often problematic, suggesting that in vivo mechanisms for efficiently folding the diversity of conotoxins have been evolved by the cone snails. We demonstrate here that the correct folding of a Conus peptide is facilitated by a posttranslationally modified amino acid, gamma-carboxyglutamate. In addition, we show that multiple isoforms of protein disulfide isomerase are major soluble proteins in Conus venom duct extracts. The results provide evidence for the type of adaptations required before cone snails could systematically explore the specialized biochemical world of "microproteins" that other organisms have not been able to systematically access. Almost certainly, additional specialized adaptations for efficient microprotein folding are required.
Jones, R.M. and Bulaj, G. (2000)Conotoxins: New vistas for peptide therapeutics. Current Pharmaceutical Design August 2000 Volume 6 number 12, 1249-1285. Full article available.
Nielsen J, Buczek P, Bulaj G "Cosolvent-Assisted Oxidative Folding of a Bicyclic (-Conotoxin ImI" J Pept Science, in press
Keizer DW, West PJ, Lee EF, Yoshikami D, Olivera BM, Bulaj G, Norton RS (2003) "Structural basis for tetrodotoxin-resistant sodium channel binding by (delta-conotoxin SmIIIA" J Biol Chem, 278, 46805-46813
Dela Cruz R, Whitby F, Buczek O, Bulaj G (2003) "Detergent-assisted oxidative folding of omega-Conotoxins" J Pept Research 61, 202-212
Abstract:Conotoxins comprise a diverse group of disulfide-rich peptides found in venoms of predatory Conus species. The native conformation of these peptides is marginally stable in comparison with alternative conformations, often resulting in low folding yields. The oxidative folding of hydrophobic delta-conotoxins was found to produce less than 1% of the native peptide [Bulaj, G. et al. (2001) Biochemistry 40, 13201]. In order to identify factors that might improve folding yields, we screened a number of additives including water-soluble polymers, detergents and osmolytes for their ability to increase steady-state accumulation of the native delta-conotoxin PVIA. The presence of a non-ionic detergent Tween and low temperature appeared to be the most effective factors in improving the oxidative folding. The detergent was also effective in promoting folding of other hydrophobic delta-conotoxins. Based on our findings, we discuss a possible mechanism for detergent-assisted folding and the general applicability of this mechanism to facilitating the proper folding of hydrophobic, cysteine-rich peptides.
West PJ, Bulaj G, Garrett JE, Olivera BM, Yoshikami D. (2002) "(delta-Conotoxin SmIIIA, a Potent Inhibitor of Tetrodotoxin-Resistant Sodium Channels in Amphibian Sympathetic and Sensory Neurons" Biochemistry 41, 15388-15393
Miles LA, Dy CY, Nielsen J, Barnham KJ, Hinds MG, Olivera BM, Bulaj G, Norton RS. (2002) "Structure of a novel P-superfamily spasmodic conotoxin reveals an inhibitory cystine knot motif" J Biol Chem 277, 43033-40
Castellino, F.J. and Prorok, M. (2000) Conantokins: Inhibitors of ion flow through the N-Methyl-D-Aspartate receptor channels Current Drug Targets 1: 230-235.
Full text
Abstract:Calcium flow through the ion channel of the N-methyl-D-aspartate receptor (NMDAR) has been implicated as contributing to a variety of neuropathologies. This receptor is a complex heteromeric oligomer consisting of different types of subunits, the nature of which governs its properties, as well as its response to a variety of agonists, antagonists, and other types of inhibitors. A new natural series of NMDAR inhibitors, the conantokins, have been shown to be present in the venoms of snails within the genus, Conus. These agents appear to function by inhibition of the spermine/spermidine stimulation of ion flow through the NMDAR channel. These small peptides (17-27 amino acid residues) are highly processed post-translationally. One such processing event is the vitamin K-dependent gamma-carboxylation of glutamate, resulting in placement of gamma-carboxyglutamic acid residues in these peptides. As a result, these peptides then possess the ability to interact with divalent metal ions and concomitantly undergo a conformational alteration. Rational drug design based on the characteristics of these promising peptides requires knowledge of their properties and the manner in which they target the NMDAR. This review summarizes current knowledge in this area.
See also Prorok, M. and Castellino, F.J. (2001)Structure-Function Relationships of the NMDA Receptor Antagonist Conantokin Peptides. Current Drug Targets 2: 313-321. or (Full text)
Steven G. Charapata and David Ellis (2002) Unintentional overdose with intrathecal ziconotide.Pain Medicine 3:(2) 189-190.
Abstract:Ziconotide is a novel, N-type, voltage-sensitive calcium channel (VSCC) blocker, with well-documented efficacy as an intrathecal (IT) analgesic. Ziconotide has been administered to over 1000 chronic pain patients in nine clinical trials. Over 350 patients have been on ziconotide IT therapy for more than three months in a long-term safety and tolerability study. Common adverse events for ziconotide include dizziness, nausea, nystagmus, abnormal gait, constipation, urinary retention, somnolence, postural hypotension, vomiting, confusion and abnormal vision. Ziconotide adverse events are recognizable, reversible and manageable, by dose adjustment and slow dose titration. Case reports of unintentional overdose in six chronic pain patients treated with IT ziconotide are presented. These unintentional overdoses were attributable to pump programming or dilution errors; none were lethal. The patient who received the highest overdose was administered 31 mcg/hr over 24 hours, or nearly 750 mcg ziconotide, total. This hourly dose rate is 300-fold the current recommended initial dose rate of 0.1 mcg/hr. This patient was sedated, but arousable; vital signs were stable and patient had no change in blood pressure. His symptoms resolved within 24 hours. His Visual Analog Score of Pain Intensity (VASPI) was reduced from 82 at baseline to 2.5 at the end of the titration period. The patient elected to continue in the long-term IT ziconotide study. The other 5 cases of inadvertent overdose were less severe, with dose rate at 5 mcg/hr or less. Associated adverse events also resolved within 24-hours of discontinuing ziconotide infusion. Unlike an unintentional overdose with IT morphine, which slows respiration and could potentially lead to hypoxia, coma or death; ziconotide does not produce respiratory depression. No tolerance to the analgesic effect of ziconotide, or withdrawal symptoms after discontinuation of the drug have been reported. Ziconotide has a wide margin of safety as an IT analgesic.
Cai Yingya
(2002) Marine Mollusca of Guangdong 2. 94pp., figs., in Chinese
softcover, Small size: 185x115mm. ISBN: 7-81036-098-1
(Euro 8.00)
Abstract:
This guide deals with 125 species from the families Muricidae,
Columbellidae, Buccinidae, Galeodidae, Nassariidae, Fasciolariidae,
Olividae, Mitridae, Harpidae, Volutidae, Cancellariidae, Marginidae,
Conidae, Turridae, Terebridae, Architectonidae, Janthinidae and
Epitoniidae.
Cho, C.H., Song, W., Leitzell, K., Teo, E., Meleth, A.D., Quick, M.W. and Lester, R.A. (2005) Rapid upregulation of alpha7 nicotinic acetylcholine receptors by tyrosine dephosphorylation. J. Neurosci. 25: 3712-3723.
Department of Neurobiology, University of Alabama at Birmingham, Birmingham, Alabama 35294-0021, USA.
Abstract: Alpha7 nicotinic acetylcholine receptors (nAChRs) modulate network activity in the CNS. Thus, functional regulation of alpha7 nAChRs could influence the flow of information through various brain nuclei. It is hypothesized here that these receptors are amenable to modulation by tyrosine phosphorylation. In both Xenopus oocytes and rat hippocampal interneurons, brief exposure to a broad-spectrum protein tyrosine kinase inhibitor, genistein, specifically and reversibly potentiated alpha7 nAChR-mediated responses, whereas a protein tyrosine phosphatase inhibitor, pervanadate, caused depression. Potentiation was associated with an increased expression of surface alpha7 subunits and was not accompanied by detectable changes in receptor open probability, implying that the increased function results from an increased number of alpha7 nAChRs. Soluble N-ethylmaleimide-sensitive factor attachment protein receptor-mediated exocytosis was shown to be a plausible mechanism for the rapid delivery of additional alpha7 nAChRs to the plasma membrane. Direct phosphorylation/dephosphorylation of alpha7 subunits was unlikely because mutation of all three cytoplasmic tyrosine residues did not prevent the genistein-mediated facilitation. Overall, these data are consistent with the hypothesis that the number of functional cell surface alpha7 nAChRs is controlled indirectly via processes involving tyrosine phosphorylation.
Concar, D. (1996) Doctor snail. (cone snail venom) New Scientist, 152: 26-28.
.
Abstract: Filipino biochemist Baldomero Olivera and his colleagues at the University of Utah in Salt Lake City observed a variety of weird effects when toxins from cone snail venom were injected into the brains of laboratory mice. Cone snail venom contains hundreds, even thousands of toxins. Potential applications of snail toxins include the relief of serious pain, brain damage prevention, and the treatment of depression, epilepsy and schizophrenia.
Coomans & al., 1979-86. "Alphabetical revision of the (sub) species in
recent Conidae 1-9". 469pp., 760figs., in 9 issues. Hfl. 120.00
Conticello, S. G., Pilpel, Y., Glusman, G. and Fainzilber, M. (2000) "Position-specific codon conservation in hypervariable gene families."
Trends in Genetics 16:57-59 (2000).
Abstract:
Reference concerning of the third nucleotide (T or C) in two codons (TGT or TGC) that code for
Cysteine. Analysis of cysteine codon usage in a number of hypervariable gene families revealed
strict codon conservation in specific positions adjacent to or within the hypervariable regions
of these genes. This phenomenon suggests the possible existence of specific positional
codon-conservation mechanisms in certain genes. The phenomenon of position-specific codon
conservation may provide a functional-genomics aproach to identify important residues for
further structural and functional study. Moreover, this observation suggests that novel
mechanisem could exist to conserve crucial resides in hypervariable gene families.
Cartier, G.E., Yoshikami, D., Gray, W.R., Luo, S., Olivera, B.M. and
McIntosh, M. (1996) A new alph-conotoxin which targets alpha3beta2 nicotinic
acetylcholine. J. Biol. Chem. 271: 7522-7528.
[Abstract:[Conus magus, alpha-conotoxin
MII, 16aa peptide, blocks nAChR composed of alpha3beta2 subunits (IC50=0.5nM), some 2-4
orders of magnitude less potent against other subunit combinations, electrophysiology,
Voltage clamp of Xenopus oocytes, venom extraction, RPLC purification,
pyridylehthylation and RPLC purification, alpha 4-7 group, In vivo, in contrast to
MI, MII had no effect i.p. in Swiss Webster mice or i.m. in goldfish; preferentially
targets neuronal-type vs. muscle-type nAChRs]
Chen, J.S., Fan, C.X., Hu, K.P., Wei, K.H. and Zhong, M.N.(1999)
Studies on conotoxins of Conus betulinus.
J. Nat. Toxins 8: 341-349.
[Abstract:The biological activity and toxicity
of crude venom from Conus betulinus, which was collected from the South China Sea, were
studied. The venom shows Ach receptor activity, K+ current effect, and low toxicity.
Four peptide components, named BeTXIa, BeTXIb, BeTXIIa, and BeTXIIb, were purified by
gel-filtration with Sephadex followed by HPLC, and finally sequenced on an ABI model 491
sequencer. The low-molecular-weight peptides BeTXIa and b have 14 and 15 amino acid
residues, respectively, while BeTXIIa and b have 27 and 30 amino acid residues,
respectively. The results indicate that BeTXs from the venom of C. betulinus are a set
of small peptides with a high cysteine content like known conotoxins. However, it is
meaningful to find that these sequences have specific chemical characteristics in their
cysteine framework which differ greatly from known cysteine frameworks in conotoxin
structures.]
Clench, W.J., Kondo, Y.(1943) The poison cone shell. Amer. J. Trop. Med. 23, 105-
CLENCH & al., 1946. The Poison Cone Shell. 27pp., 5pls.
Eugene V. Coan, Alan R. Kabat & Richard E. Petit (2004), "2,400 Years of Malacology," is online at http://erato.acnatsci.org/ams/publications/epubs.html
This publication is a comprehensive catalog of biographical and bibliographical papers on malacologists, conchologists, paleontologists, and others with an interest in mollusks. At present, the catalog is over 600 pages and indexes over 5,000 individuals. This catalog is a work in progress, and we will be posting updated versions periodically. Readers are encouraged to explore and use this catalog, and to forward to their comments to the authors.
Colledge, C.J., Hunsperger, J.P., Imperial J.S., Hillyard, D.R. (1992) Precursor structure of w -conotoxin GVIA determined from a cDNA clone. Toxicon 30: 1111-1116.
COOMANS & al., 1979-86. Alphabetical revision of the (sub) species in
recent Conidae 1-9. 469pp., 760figs., in 9 issues. Euro 56.00
Craig. A.G., Jimenez, E.C., Dykert, J., Nielsen, D.B., Gulyas, J.,
Abogadie, F.C., Porter, J., Rivier, J.E., Cruz, L.J., Olivera, B.M. and McIntosh, M.
(1997) A novel post-translational modification involving bromination of tryptophan -
Identification of the residue, L-6-bromotryptophan, in peptides from Conus imperialis
and Conus radiatus venom.J. Biol. Chem. 272, 4689-4698. [Abstract:[describes a novel
post-translational modification (halogenation of tryptophan) of a heptapeptide isolated
from the imperial cone, Conus imperialis, a worm-eating cone, and from a
33-amino acid peptide from the radial cone, Conus radiatus, a fish-eating
cone. "The occurrence of 6-bromotryptophan in Conus peptides could be due to an
adaptation involving the recruitment of an enzymatic system already generally distributed
among marine organisms, the cone snails have used this more general bromination chemistry
evolved in marine ecosystems in a specialized way in their venom ducts".]
Craig, A. G., Norberg, T., Griffin, D., Hoeger, C., Akhtar, M., Schmidt, K., Low, W., Dykert, J., Richelson, E., Navarro, V., Mazella, J., Watkins, M., Hillyard, D., Imperial, J., Cruz, L. J., Olivera, B. M. (1999). "Contulakin-G, an O-Glycosylated Invertebrate Neurotensin" J. Biol. Chem. 274: 13752-13759.
[Contulakin-G is a 16 amino acid O-linked glycopeptide (pGlu-Ser-Glu-Glu-Gly-Gly-Ser-Asn-Ala-Thr-Lys-Lys-Pro-Tyr-Ile-Leu-OH, pGlu is pyroglutamate) from Conus geographus, whose C-terminus resembles neurotensin. Causes motor control-associated dysfunction when injected into mice. The investigators conclude "that O-linked glycosylation appears to be a highly unusual strategy for increasing the efficacy of toxins directed against neurotransmitter receptors"].
Costa, F.H.A. (1996) "Natural history and evolution patterns in Conus californicus Hinds in Reeve, 1844". La Conchiglia, Jan-March, pp. 44-52.
[Abstract: Conus californicus: Most cones are crepuscular, but there is always an exception to the rule. A good example is Conus californicus which is durnal.]
Cui C, Booker TK, Allen RS, Grady SR, Whiteaker P, Marks MJ, Salminen O, Tritto T, Butt CM, Allen WR, Stitzel JA, McIntosh JM, Boulter J, Collins AC, Heinemann SF. (2003) The beta3 nicotinic receptor subunit: a component of alpha-conotoxin MII-binding nicotinic acetylcholine receptors that modulate dopamine release and related behaviors. J Neurosci. 23: 11045-11053.
Nigrostriatal dopaminergic neurons express many nicotinic acetylcholine receptor (nAChR) subunits capable of forming multiple nAChR subtypes. These subtypes are expressed differentially along the neuron and presumably mediate diverse responses. beta3 subunit mRNA has restricted expression but is abundant in the substantia nigra and ventral tegmental areas. To investigate the potential role(s) of nicotinic receptors containing the beta3 subunit in dopaminergic tracts, we generated mice with a null mutation in the beta3 gene. We were thereby able to identify a population of beta3-dependent alpha-conotoxin MII-binding nAChRs that modulate striatal dopamine release. Changes were also observed in locomotor activity and prepulse inhibition of acoustic startle, behaviors that are controlled, in part, by nigrostriatal and mesolimbic dopaminergic activity, respectively, suggesting that beta3-containing nAChRs modulate these behaviors.
Craig, A.G., Park, M., Fischer, W.H., Kang, J., Compain, P. and Piller, F.
(2001) Enzymatic glycosylation of contulakin-G, a glycopeptide isolated from
Conus venom, with a mammalian ppGalNAc-transferase. Toxicon, 39: 809-817..
Abstract: We have determined that the mammalian uridine
diphospho-N-acetyl-d-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1 (EC 2.4.1.41) has the appropriate acceptor substrate specificity to recognize the non-glycosylated form of contulakin-G (ZSEEGGSNATKKPYIL-OH where Z=pyroglutamic acid) and to transfer GalNAc to the peptide. Both [Thr10] contulakin-G and a pre-contulakin-G30-66 (RGLVPDDITPQLILGSLISRRQSEEGGSNATKKPYIL-OH) were shown to be acceptors for the mammalian enzyme. The site of attachment of the GalNAc residue was determined using chemical and radioactive sequencing techniques. The mammalian enzyme was highly specific for Thr10 residue, in which the native peptide was found to be glycosylated, compared with either Ser2 or Ser7. In the case of pre-contulakin-G, the enzyme was also highly specific for the equivalent threonine residue. These results suggest that the Cone snail uses an enzyme with similar acceptor specificity to that of the mammalian polypeptide N-acetylgalactosaminyltransferase for glycosylating contulakin-G.
Craig, A.G., Zafaralla, G., Cruz, L.J., Santos, A.D., Hillyard, D.R., Dykert, J., J.E., Gray, W.R., Imperial, J., DelaCruz, R.G., Sporning, A., Terlau, H., West, P.J.,
Yoshikami, D. and Olivera, B.M. (1998) An O-glycosylated neuroexcitatory Conus peptide.Biochemistry,37: 16019-16026..
Abstract: A study was conducted to describe a unique peptide resulting from the venom of the fish-hunting cone snail Conus striatus. An analytical Vydac C18 column was utilized to purify crude venom extract while lyophilized venom was suspended in an acetic acid solution. Experimental results indicated that the venom, which generates spastic paralysis in fishes, features several biochemical and physiological properties.
Cruz, L.Z., Gray, W.R. and Olivera, B.M. (1978) Purification and
properties of a myotoxin from Conus geographus. Archs. Biochem. Biophys. 190:
539-548.
[Abstract:[ Conus geographus, paralysis of respiratory muscles in mice]
Cruz, L.J. and White, J. (1995) Clinical toxicology of Conus snail stings. In : Meier, J., White, J. (Eds.) Clinical Toxicology of Animal Venoms. CRC Press, Boca Raton, FL. p. 117.
Cruz, LJ and Jimenez, EC (2004) Conus venom neuropeptides Encyclopedia of Neuroscience 3rd Edition, Edited by George Adelman and Barry H. Smith, CD-ROM,p.291 ISBN: 0444514325, Elsevier, BV.
Includes video clip showing envenomation of a small fish by a piscivorous cone shell.
Currie BJ. (2000) Clinical toxicology: a tropical Australian perspective. Ther Drug Monit. 22 : 73-78.
Tropical Medicine and International Health Unit, Menzies School of Health Research, Darwin, Northern Territory, Australia.
Abstract: Tropical Australia has an amazing diversity of venomous fauna, from "the world's most venomous creature," the multi-tentacled (chirodropid) box jellyfish Chironex fleckeri, to aggressive spiders whose venom remains to be characterized. All genera of highly venomous Australasian elapid snakes are present, except for tiger snakes. Most notable is the taipan (Oxyuranus scutellatus), with the most efficient "snap-release" biting mechanism of any snake and venom components causing the full constellation of clinical envenoming features: coagulopathy from fibrinogen depletion (procoagulant), neurotoxicity (predominantly presynaptic neurotoxin) and rhabdomyolysis (myotoxin). Brown snakes (Pseudonaja textilis and P. nuchalis) now account for most snake bite fatalities in Australia, as a result of severe coagulopathy and a poorly defined early scenario of collapse, postulated to be caused by profound hypotension caused by transient myocardial dysfunction associated with prothrombin activation. Other venomous entities include paralyzing ticks, the blue-ringed octopus, stone fish and other marine animals with venomous spines, paralyzing cone shells, and a wide range of jellyfish including Carukia barnesi and possibly other four-tentacled (carybdeid) box jellyfish causing the Irukandji syndrome.
Currie BJ. (2003) Marine antivenoms. J Toxicol Clin Toxicol. 41: 301-308.
Tropical Medicine and International Health Unit, Menzies School of Health Research, Darwin, Northern Territory, Australia. bart@menzies.edu.au
Abstract There is an enormous diversity and complexity of venoms and poisons in marine animals. Fatalities have occurred from envenoming by sea snakes, jellyfish, venomous fish such as stonefish, cone snails, and blue-ringed octopus. Deaths have also followed ingestion of toxins in shellfish, puffer fish (Fugu), and ciguatoxin-containing fish. However antivenoms are generally only available for envenoming by certain sea snakes, the major Australian box jellyfish (Chironex fleckeri) and stonefish. There have been difficulties in characterizing the toxins of C. fleckeri venom, and there are conflicting animals studies on the efficacy of C. fleckeri antivenom. The vast majority of C. fleckeri stings are not life-threatening, with painful skin welts the major finding. However fatalities that do occur usually do so within 5 to 20 minutes of the sting. This unprecedented rapid onset of cardiotoxicity in clinical envenoming suggests that antivenom may need to be given very early (within minutes) and possibly in large doses if a life is to be saved. Forty years of anecdotal experience supports the beneficial effect of stonefish antivenom in relieving the excruciating pain after stonefish spine penetration. It remains uncertain whether stonefish antivenom is efficacious in stings from spines of other venomous fish, and the recommendation of giving the antivenom intramuscularly needs reassessment.
Dall, (1911). Summary of the shells of the genus Conus from the Pacific coast
of America in the U.S.N.M. 12pp.
Daly NL, Ekberg JA, Thomas L, Adams DJ, Lewis RJ, Craik DJ. (2004) Structures of mu O-conotoxins from Conus marmoreus: Inhibitors of TTX-sensitive and TTX-resistant sodium channels in mammalian sensory neurons. J Biol Chem. 2004 Mar 24 [Epub ahead of print]
Centre for Drug Design and Development, Institute for Molecular Bioscience, Brisbane, QLD 4072.
The muO-conotoxins are an intriguing class of conotoxins targeting various voltage-dependent sodium channels and molluscan calcium channels. In the current study, we have shown MrVIA and MrVIB to be the first known peptidic inhibitors of the transient tetrodotoxin-resistant (TTX-R) Na+ current in rat dorsal root ganglion neurons, in addition to inhibiting tetrodotoxin-sensitive Na+ currents. Human TTX-R sodium channels are a therapeutic target for indications such as pain, highlighting the importance of the muO-conotoxins as potential leads for drug development. Furthermore, we have used NMR spectroscopy to provide the first structural information on this class of conotoxins. MrVIA and MrVIB are hydrophobic peptides that aggregate in aqueous solution but were solubilized in 50% acetonitrile/water. The three-dimensional structure of MrVIB consists of a small betasheet and a cystine knot arrangement of the three-disulfide bonds. It contains four backbone loops between successive cysteine residues that are exposed to the solvent to varying degrees. The largest of these, loop 2, is the most disordered part of the molecule, most likely due to flexibility in solution. This disorder is the most striking difference between the structures of MrVIB and the known delta- and omega-conotoxins, which along with the muO-conotoxins are members of the O superfamily. Loop 2 of omega-conotoxins has previously been shown to contain residues critical for binding to voltage-gated calcium channels and it is interesting to speculate that the flexibility observed in MrVIB may accommodate binding to both sodium and molluscan calcium channels.
DAUTZENBERG, PH. ET AL., 1935-1939.
Résultats Scientifiques du Voyage aux Indes Orientales Néerlandaises. Vol. II. Deuxième partie. Gastérapodes marins. 1.
Terebridae. 2. Mitridae. 3. Conidae. Prosobranchia et Opisthobranchia. Gastropoda-Pulmonata, Scaphopoda et Bivalvia; 827
p., num. figs, 22 (9 col.) pls, paperbound. Unopened copy. Published in: Mémoires du Musée royal d'Histoire Naturelle.
(DAUTZENBERG, 1935) :
Résultats Scientifiques du Voyage aus Indes Orientales Néerlandaises de LL. AA. RR. le Prince & la Princesse Léopold de Belgique; containing:
DAUTZENBERG, 1935. 2(17). Gastéropodes marins. 1. Familie Terebridae.&:
DAUTZENBERG, 1935. Résultats Scientifiques du Voyage aus Indes Orientales Néerlandaises de LL. AA. RR. le Prince & la Princesse Léopold de Belgique, 2(18). Gastéropodes marins. 3. Familie Conidae. 282pp., 3colour pls., cover
poor, some staining.
DAUTZENBERG, PH., 1937.
Résultats Scientifiques du Voyage aux Indes Orientales Néerlandaises. Gastérapodes marins. 3. Conidae; 284 p., 3 col. pls,
roy. 4to, paperbound. Unopened copy. Published in: Mémoires du Musée royal d'Histoire Naturelle.
DAUTZENBERG, P.(1978) 1. Gastéropodes Marins. 1. Famille Terebridae; 2. Famille Mitridae; 3. Famille Conidae. by DAUTZENBERG, P. Bruxelles 1935-37. 2 volumes. 4to. pp. 208; 284, with 7 coloured plates. Green half morocco, richly gilt spines. Published as parts of 'Résultats scientifiques du Voyage aux Indes Orientales Néerlandaises de LL. AA. RR. le Prince et la Princesse Léopold de Belgique' by V. Van Staelen. (Keywords MOLLUSCA DUTCH EAST INDIES) [Abstract:[Interesting book on conidae]
DAVOLI, 1972. Studi monografici sulla malacologia miocenica modenese 1. - I
Molluschi Tortoniani di Montegibbio [Gastropoda (seguito): fam. Conidae].
104pp., 9pls., 40figs., 24tabs., English summ.
Decker MW, Meyer MD, Sullivan JP. (2001) The therapeutic potential of nicotinic acetylcholine receptor agonists for pain control. Expert Opin Investig Drugs. 2001 Oct;10(10):1819-1830
Dept. 4N5, Building AP-9A/3, 100 Abbott Park Rd., Abbott Park, IL 60064-6125, USA. michael.w.decker@abbott.com
Due to the limitations of currently available analgesics, a number of novel alternatives are currently under investigation, including neuronal nicotinic acetylcholine receptor (nAChR) agonists. During the 1990s, the discovery of the antinociceptive properties of the potent nAChR agonist epibatidine in rodents sparked interest in the analgesic potential of this class of compounds. Although epibatidine also has several mechanism-related toxicities, the identification of considerable nAChR diversity suggested that the toxicities and therapeutic actions of the compound might be mediated by distinct receptor subtypes. Consistent with this view, a number of novel nAChR agonists with antinociceptive activity and improved safety profiles in preclinical models have now been identified, including A-85380, ABT-594, DBO-83, SIB-1663 and RJR-2403. Of these, ABT-594 is the most advanced and is currently in Phase II clinical evaluation. Nicotinically-mediated antinociception has been demonstrated in a variety of rodent pain models and is likely mediated by the activation of descending inhibitory pathways originating in the brainstem with the predominant high-affinity nicotine site in brain, the alpha4beta2 subtype, playing a critical role. Thus, preclinical findings suggest that nAChR agonists have the potential to be highly efficacious treatments in a variety of pain states. However, clinical proof-of-principle studies will be required to determine if nAChR agonists are active in pathological pain.
DELSAERDT, 1990. Conus visseri a n.sp. from Phuket Isl. Note on C. coffeae. 4pp., 10figs., Dutch summ.
DELSAERDT, 1990. Complementary information concerning Conus lemuriensis &
C. milneedwardsi. 2pp., 1fig., in English & Dutch. Euro 0.50
DELSAERDT, 1990. Conus visseri a n.sp. from Phuket Isl. Note on C. coffeae.
4pp., 10figs., Dutch summ. Euro 0.60
DODGE, H., 1953.
A Historical Review of the Mollusks of Linneaus. Part 2. The Class Cephalopoda and the Genera Conus and Cypraea of the Class Gastropoda; 134 p., paperbound. Published in: Bulletin of the American Museum of Natural History.
Doughty, S.W., Blaney, F.E., Orlek, B.S., Richards, W.G.(1998) A molecular mechanism for toxin block in N-type calcium channels. Protein Eng 11: 95-99.
Duda, T.F., Jr. and Rolán, E. (2004). Explosive radiation of Cape Verde Conus, a marine species flock. Molecular Ecology (in press).
Duda, T.F., Jr., Kohn, A.J. (2004). Species-level phylogeography and evolutionary history of the hyperdiverse marine gastropod genus Conus. Molecular Phylogenetics and Evolution (in press).
Duda Jr TF, Palumbi SR. (2004) Gene expression and feeding ecology: evolution of piscivory in the venomous gastropod genus Conus. Proc R Soc Lond B Biol Sci. 271: 1165-1174.
Naos Marine Laboratory, Smithsonian Tropical Research Institute, Box 2072, Balboa, Ancon, Republic of Panama.
Abstract: Differential expression of gene-family members is typically associated with the specific development of certain tissues and organs, but its importance in the ecological adaptation of organisms has rarely been investigated. Several specialized feeding modes have evolved within the predatory marine gastropod genus Conus, including molluscivory and piscivory. Based on phylogenetic investigations of Conus species, it has been concluded that piscivory arose at least twice in this genus. Moreover, molecular analyses of conotoxin mRNA transcripts reveal that piscivores from independent evolutionary lineages express the same subset of four-loop conotoxins, contrary to phylogenetic expectations. These results demonstrate that differential expression of gene-family members can play a key role in adaptive evolution, particularly during shifts to new ecological niches.
Duda Jr TF, Jon-Paul Bingham, Bruce G. Livett, Alan J. Kohn, Gabriella Raybaudi Massilia, Joseph R. Schultz, John Down, David Sandall and Jonathan V. Sweedler; and Mike Fainzilber (2004) How Much at Risk Are Cone Snails? ;Response: Eric Chivian, Callum M. Roberts and Aaron S. Bernstein Science 303: (Feb 13 2004) 955-957.
Ekberg, J.A., Adams, D.J., Mould, J., Baker, M.D., Wood, J.N. and Lewis, R.(2005) The µO-conotoxin MrVIB selectively inhibits the TTX-resistant voltage-sensitive
sodium channel Nav1.8 but not Nav1.9. Proc. 25th Annual Meeting, Australian Neuroscience Society. Perth, 25 January-2 February 2005, POS-MON-092
Eichorn, A.(1916) - Die Herstellung von Muschelperlen aus Conus auf der Insel Ponam und ihre Verwendung im Kunsthandwerk der Admiralitaetsinsulaner. Baessler-Archiv, Vol. V, No. 6, 1916, pp. 256-283.
Eldabe, S. (2007) Ziconotide: a new option for intrathecal analgesia. Future Neurology, January 2007, Vol. 2, No. 1, Pages 11-19.
Consultant in Anaesthesia & Pain Management, The James Cook University Hospital, Middlesbrough, TS4 3BW, UK.
Abstract:Ziconotide is the synthetic equivalent of a neuroactive peptide found in the venom of the fish-hunting marine snail Conus magus. Its analgesic effect is mediated by a blockade of the N-type calcium channel in the dorsal horn of the spinal cord. The drug is currently licensed for continuous intrathecal infusion in the treatment of chronic intractable pain, and its analgesic efficacy has been demonstrated in both animal and human studies. Ziconotide-induced analgesia is not associated with the development of tolerance, respiratory depression or endocrine side effects, as is common in opioids. Ziconotide is a potent analgesic with a narrow therapeutic window. A low starting dose with slow upward titration, while monitoring the patient, is the recommended strategy for avoiding the more serious side effects, such as delirium, acute psychotic reactions, suicidal ideation and coma.
Rachid El Kouhen, Carol S Surowy, Bruce Bianchi, Torben Neelands, Heath McDonald, Wende Niforatos, Arthur Gomtsyan, Chih-Hung Lee, Prisca Honore, James Sullivan, Michael Jarvis, and Connie Faltynek (2005) A-425619, a Novel and Selective TRPV1 Receptor Antagonist, Blocks Channel Activation by Vanilloids, Heat and Acid. J. Pharmacol. Exp. Ther. published 18 April 2005, 10.1124/jpet.105.084103
Emerson & al., 1962. Resultats of the Puritan-AMNH Expedition to W.ern
Mexico. 16. The Recent Mollusks: Gastropoda, Conidae. 44pp., 20figs.
Hfl. 13.50
Emerson 1968. A Record of the Indo-Pacific Cone, Conus ebraeus, in
Guatemala. 1p. Hfl. 1.00
Eichorn, A.(1916) - Die Herstellung von Muschelperlen aus Conus auf der Insel Ponam und ihre Verwendung im Kunsthandwerk der Admiralitaetsinsulaner. Baessler-Archiv, Vol. V, No. 6, 1916, pp. 256-283.
Endean R, Gyr P, Surridge J.(1979)The effects of crude venoms of Conus magus and Conus striatus on the contractile response and electrical activity of guinea-pig cardiac musculature.
Toxicon. 17(4):381-95.
Endean R, Gyr P, Surridge J. (1977) The pharmacological actions on guinea-pig ileum of crude venoms from the marine gastropods Conus striatus and Conus magus.
Toxicon. 15(4):327-37.
Endean, R. and Rudkin, C. (1963) Studies on the venoms of some Conidae. Toxicon 1, 49 (1963)
Endean, R. and Rudkin, C. (1965) Further studies of the venoms of Conidae. Toxicon. 69: 225-249. No abstract available.
Endean R, Surridge J, Gyr P. (1977) Some effects of crude venom from the cones Conus striatus and Conus magus on isolated guinea-pig atria.
Toxicon. 15(5):369-74.
Endean R, Williams H, Gyr P, Surridge J. (1976) Some effects on muscle and nerve of crude venom from the gastropod Conus striatus.
Toxicon. 14(4):267-74.
Endean R, Parish G, Gyr P. (1974) Pharmacology of the venom of Conus geographus.
Toxicon. 12(2):131-8.
Endean R, Gyr P, Parish G. (1974) Pharmacology of the venom of the gastropod Conus magus.
Toxicon. 12(2):117-29.
Endean R, Duchemin C. (1967) The venom apparatus of Conus magus.
Toxicon. 4(4):275-84.
Fainzilber,
M., Napchi, I., Gordon, D. and Zlotkin, E. (1994) Marine warning via peptide toxin.
Scientific Correspondence, Nature (Lond.) 369: 192-193.
[Abstract:[ C. striatus, C. textile, C. pennaceus,
C. nussatella, C. arenatus, C. tesselatus, C. generalis, C. flavidus,
C. rattus, C. parvatus, C. ventricosus, and Strombus. The results suggest
the existence of phylogenetically specific alarm cues in Conidae. Only
the molluscivorous species venoms were active against Strombus.
This is the first
documented case of a defined peptide acting as an interspecific
alarm cue in marine ecosystems.]
Fainzilber,
M., Hasson, A., Oren, R., Burlingame, A.L., Gordon, D., Spira, M.E. and Zlotkin, E. (1994)
New mollusc-specific alpha-conotoxins block Aplysia neuronal acetylcholine
receptors. Biochemistry 33: 9523 - 9529.
[Abstract:[ Conus pennaceus, alpha-CTX-PnIA/B, block
neuronal nAChR in Aplysia, but not in brain of rat or fish]
Fainzliber, M, Gordon, D, Hasson, A, Spira, M E, Zlotkin, E. (1991).
Mollusc-specific toxins from the venom of Conus textile neovicarius. EUR J BIOCHEM 202 2
1991 EJBCA European Journal of Biochemistry 0014-2956 589-596.
Fainzilber, M., Masson, A., Oren, R., Burlingame, A.L., Gordon, D.,
Spira, M.E. and Zlotkin, E. (1994) New mollusc specific a-conotoxins block Aplysia
neuronal acetylcholine receptors. Biochemistry 33: 9523-9529.
Fainzilber, M., Kofman, O., Zlotkin, E. and Gordon, D. (1994) The
new neurotoxin site on sodium channels is identified by a conotoxin that affects sodium
channel inactivation in molluscs and acts as an antagonist in the rat brain. J. Biol.
Chem. 269: 2574-2580.
[Abstract:[ Conus textile, delta-CTX-TxVIA, slows sodium current
inactivation in mollusc neurons, protects toxic effects of textile venom in rat brain, 6
Cys/4 loop framework]
Fainzilber, M., Nakamura, T., Gaathon, A., Lodder, J.C., Kits, K.S.,
Burlingame, A.L. and Zlotkin, E. (1995) A new cysteine framework in sodium channel
blocking conotoxins. Biochemistry 34: 8649-8656.
[Abstract:[ Conus pennaceus, mu-CTX-PnIVA/B,
block sodium channels in molluscan neurons, no effect on sodium currents in bovine
chromaffin cells or in rat brain synaptosomes]
Cherry Farrow of The Guardian wrote on Conus, and its potential to provide a breakthrough in the fight against chronic pain.
Small creature, big potential, The Guardian, Thursday February 12, 2004.
For thousands of years, medical research has depended on plants, animals and microbes to understand and treat human disease. Now increasing attention is being paid to animals for sources of new medicines. One of the most unlikely and beautiful is a small, deadly mollusc - the cone snail.
There is growing excitement among scientists that this marine snail may provide a breakthrough in the development of a series of new painkillers. Cone snails may contain more medicines than any other animal.
A new synthetic drug, Prialt, is now at an advanced stage in clinical trials for the treatment of what is classed as intractable pain - unremitting, untreatable pain. Prialt, derived from the venom or conotoxin of the snail, may be 1,000 times stronger than morphine but without the tolerance or addiction usually associated with opiates.
Cone snails live in shallow tropical waters, on reefs, in mangrove swamps and mud flats. There are thought to be approximately 500 species, although research has focused mainly on three.
The snails have a little harpoon or fleshy foot from which they inject a lethal cocktail of toxins into their prey - other molluscs, worms and fish. They can "shake" the cocktail and create a new mix of changing proportions so their victims cannot develop immunity. Each species has evolved to produce its own set of toxins, about 100, which means there could be as many as 50,000 conotoxins in all.
This is unprecedented in the biological world, says Aaron Bernstein, who is currently conducting research at Harvard Medical School.
"It's the sheer diversity of the chemicals they make. The cone snail is young in evolutionary terms - only 50m years old - yet each has evolved a different number of toxins. Compare this to the 10,000 known alkaloids in plants, which we have been looking at for centuries," he said.
Reseach into cone snails started 20 years ago. Experiments suggest that conotoxins could treat muscle spasticity, following spinal injury and epilepsy, that is resistant to traditional medicines. A broad spectrum anti-epileptic agent is currently in the first stage of clinical trials.
For years, scientists have searched for a medicine that is very specific, effective at low doses and does not cause side effects of addiction or tolerance. Having to keep increasing doses to achieve the same results has always limited the long-term effectiveness of the opiates used for treating severe pain. Conotoxins do not behave like that -they are very potent in small concentrations, as trials carried out on patients with Aids and cancers have shown.
"Most conotoxins are small peptides, 10 to 40 amino acids in length. They are exquisitely selective about their receptor binding sites," says Bernstein. "This makes them powerful tools for understanding how cells work, as well as a rich source for discovery of new medicines.What is remarkable about them is this ability to be so selective."
Studies suggest that conotoxins could be used to treat muscle spasticity following spinal injuries and possibly prevent cell death during strokes or head injuries. They may also help in the treatment of small-cell lung cancer. By detecting the antibodies, contoxins can provide an early diagnostic test for some types of cancer.
But it is in the treatment of "untreatable" pain that conotoxin research is furthest advanced. The first large-scale trials show just how effective the new painkiller in its synthetic form may prove to be. Trial results showed no evidence of tolerance or addictive behaviour and in feasibility studies with Aids and cancer patients with chronic pain there was relief in more than half of the patients.
All this from a small marine snail that may, in the words of Eric Chivian, founder and director of the Centre for Human Health and Global Environment at Harvard Medical School, "contain the largest and most clinically important pharmacopoeia of any genus in nature."
However, the reefs, mud and swamps in which they thrive are all under threat from over-fishing, pollution, mangrove clearance for coastal development, shrimp farming and "bioprospecting" - for private collections as well as the biomedical industry. Millions of cone snails are imported into the US and Europe every year.
"We cannot find any country that monitors this trade," says Chivian. "Although a number of researchers are careful about moving quickly to synthesise the toxins they need, others may not be. No one knows how many and what species are being sacrificed for research and for the ornamental trade in their shells," he says. Global warming is also damaging their ocean habitat. "The loss of species deprives us of invaluable tools for biomedical research. They can give us the insight into health and illness," he adds. "So just as we are appeciating the remarkable potential of the cone snail, they are coming under intense pressure."
Favreau, P., Gilles, N., Lamthanh, H., Bournaud, R., Shimahara, T., Bouet , F., Laboute, P.,
Letourneux, Y., Menez, A., Molgo, J. and Le Gall, F. (2001) A new omega-conotoxin that targets N-type voltage-sensitive calcium channels with unusual specificity. Biochemistry, 40: 14567-14576.
Abstract: Research has been conducted on the voltage-sensitive calcium channel blocker isolated from the fish-hunting cone snail's venom. Results indicate that this peptide consists of amino acid residues folded by the disulfide bridges and represents a tool for blocking N-type voltage-sensitive calcium channels.
Favreau, P., Krimm, I., Le Gall, F., Bobenrieth,
M.J., Lamthanh, H., Bouet, F., Servent, D., Molgo, J., Menez, A., Letourneux,
Y. and Lancelin, J-M. (1999) "Biochemical Characterization and Nuclear
Magnetic Resonance Structure of Novel alpha-Conotoxins Isolated from the
Venom of Conus consors". Biochemistry 38: 6317-6326.
Abstract:
[alpha-CnIA and alpha-CnIB are very similar in structure to alpha-conotoxin-MI (from C. magus). alpha-CnIA has a Tyr (Y) in position 11, instead of the Asn (N) in alpha-MI. alpha-CnIA and CnIB possess the three/five loop structure of conotoxins GI, GIA, GII,MI, SI, SIA, and SII (alpha3/5 subclass). These peptides were characterized by binding experiments with Torpedo nicotinic acetylcholine receptor (nAChR)and by NMR. alpha-CnIA appears to be a potent and selective blocker of muscle-type nAChRs as evidenced by electrophysiological recordings with amphibian and mammalian isolated neuromuscular preparations].
Fegan, D. and Andresen, D. (1997) Conus geographus envenomation. The Lancet. 349: 1672.
Fiene-Severns, P., Severns, M. and Dyerly, R. (1998) Tropical Seashells of Thailand and South East Asia. (Cone Shells, Family Conidae, p. 44) ASIA Books, ISBN 962-593-175-9.
Filmer R.M., (2001) A catalogue of nomenclature and taxonomy in the living Conidae 1758-1998; In 8vo, broch., pp. 387; LIT. 135000 (about USD 60.00) An important tool for cone collectors
Fischer, H., Liu, D.M., Lee, A., Harries, J.C. and Adams, D.J. (2005) Selective modulation of neuronal nicotinic acetylcholine receptor channel subunits by Go-protein subunits. J Neurosci. 25:3571-3577.
School of Biomedical Sciences, University of Queensland, Brisbane, Queensland 4072, Australia.
Abstract: G-protein modulation of neuronal nicotinic acetylcholine receptor (nAChR) channels in rat intrinsic cardiac ganglia was examined using dialyzed whole-cell and excised membrane patch-recording configurations. Cell dialysis with GTPgammaS increased the agonist affinity of nAChRs, resulting in a potentiation of nicotine-evoked whole-cell currents at low concentrations. ACh- and nicotine-evoked current amplitudes were increased approximately twofold in the presence of GTPgammaS. In inside-out membrane patches, the open probability (NP(o)) of nAChR-mediated unitary currents was reversibly increased fourfold after bath application of 0.2 mm GTPgammaS relative to control but was unchanged in the presence of GDPbetaS. The modulation of nAChR-mediated whole-cell currents was agonist specific; currents evoked by the cholinergic agonists ACh, nicotine, and 1,1-dimethyl-4-phenylpiperazinium iodide, but not cytisine or choline, were potentiated in the presence of GTPgammaS. The direct interaction between G-protein subunits and nAChRs was examined by bath application of either G(o)alpha or Gbetagamma subunits to inside-out membrane patches and in glutathione S-transferase pull-down and coimmunoprecipitation experiments. Bath application of 50 nm Gbetagamma increased the open probability of ACh-activated single-channel currents fivefold, whereas G(o)alpha (50 nm) produced no significant increase in NP(o). Neuronal nAChR subunits alpha3-alpha5 and beta2 exhibited a positive interaction with G(o)alpha and Gbetagamma, whereas beta4 and alpha7 failed to interact with either of the G-protein subunits. These results provide evidence for a direct interaction between nAChR and G-protein subunits, underlying the increased open probability of ACh-activated single-channel currents and potentiation of nAChR-mediated whole-cell currents in parasympathetic neurons of rat intrinsic cardiac ganglia.
Flecker, H. (1936) Cone shell mollusc poisoning, with report of a
fatal case. The Medical Journal of Australia, April 4, 1936, 464-466. [Abstract:[Conus geographus,
Haymen Is., Great Barrier Reef, North Queensland, Indo-Pacific]
Flinn JP, Pallaghy PK, Lew, M.J., Murphy, R., Angus, J.A., Norton, R.S. (1999) "Roles of key functional groups in omega-conotoxin GVIA Synthesis, structure and functional assay of selected peptide analogues". Eur J Biochem 262: 447-455.
Abstract: The contributions of various functional groups to the pharmacophore of the N-type calcium-channel blocker, GVIA, were investigated using structural and in-vitro functional studies of analogues substituted at one or two positions with non-native residues. Three functional assays (sympathetic nerve stimulation of rat isolated vas deferens, right atrium and mesenteric artery) were employed to monitor N-type calcium-channel activity. The data provide a detailed picture of which residues are important for activity [see also alanine scan Lew et al. (1997) J. Biol. Chem. 272, 12014-12023 ]. A disubstituted chimera of GVIA and omega-conotoxin MVIIA was more potent than either native molecule. The more detailed description of the GVIA pharmacophore obtained here provides a better basis for the future design of truncated peptide and peptidomimetic analogues.
Flores, C.M. and Mogil, J.S. (2001) The pharmacogenetics of analgesia: toward a genetically-based approach to pain management. Pharmacogenomics 2: 177-194.
Abstract: Interindividual differences in the experience of pain have been appreciated clinically for over a century. More recently, there has been a growing body of evidence demonstrating differences in analgesic response to various pharmacotherapies, although the source of this variability largely remains to be explained. To this end, basic science research is beginning to identify the allelic variants that underlie such antinociceptive variability using a multiplicity of animal models, and powerful genetic approaches are being exploited to accelerate this process. Although the vast majority of these studies have focused on the pharmacogenetics of opioids, owing to their prominent status as analgesics, the number of pharmacotherapies evincing genetically-based variability is rapidly expanding. In addition, analogous studies have been undertaken in humans, as a small but growing number of clinical trials have begun to evaluate prospectively the existence, if oftentimes not the origin, of interindividual differences in analgesic drug response. Importantly, with a few notable exceptions, such efforts have primarily identified differences in analgesic efficacy and/or potency between male and female human subjects. Looking toward the future development of one or more widely utilised, pharmacogenetic screens that would lead to modifications in treatment planning, at least with respect to the pharmacologic management of pain, this review will document the breadth of genetically-based variability in drug-mediated antinociception in animals. Specific examples in which the gene or genes underlying such variability have been postulated or identified will be given, while highlighting the effect of sex and its interactions with other genetic backgrounds. Finally, we will summarise and evaluate the literature on pharmacogenetic differences in human analgesic drug response, for which the influence of sex has served as one of the better studied and heuristically insightful examples.
Flores, C.M., Wilson, S.G. and Mogil, J.S. (1999) Pharmacogenetic variability in neuronal nicotinic receptor-mediated antinociception. Pharmacogenetics. 9: 619-625.
Abstract: The ability to predict interindividual differences in drug efficacy or toxicity, based on genetic factors that influence drug disposition or drug action, is fast becoming a realistic goal. The purpose of the present study was to determine whether epibatidine, a prototypical nicotinic analgesic drug, exhibits pharmacogenetic variability in antinociceptive activity. Eight inbred mouse strains (A, AKR, BALB/c, C3H/He, C57BL/6, C57BL/10, DBA/2, and SM) were surveyed for their sensitivity to the antinociceptive effects of epibatidine. All strains exhibited statistically significant antinociception that peaked between 10 and 20 min following the systemic injection of 50 microg/kg epibatidine. However, there was fourfold variability in the magnitude of peak effect between strains, with DBA/2, BALB/c and A strains showing much greater sensitivity than all others. A return to baseline nociceptive threshold at 30 min post-injection was observed for all but the A strain. In contrast, these mice exhibited significant antinociception for at least 3 h following epibatidine administration. Thus, expressing the data as area under the time-latency curve to take into account both the magnitude and duration of effect, epibatidine displayed approximately 20-fold higher antinociceptive potency in the A strain compared with the C3H/He strain. The effects of epibatidine in both the A and C3H/He strains were dose-dependent and sensitive to antagonism by the selective neuronal nicotinic channel blocker mecamylamine. Taken together, these data demonstrate the existence of pharmacogenetic variability in neuronal nicotinic receptor-mediated antinociception between inbred stains of mice and presage the potential for similar variability in analgesic response to nicotinic-based analgesics among humans. Future studies will seek to identify the chromosomal loci underlying this variability.
Franco, A. and Mari, F. (1999) "Three-dimensional structure of a-conotoxin EI determined by 1H NMR spectroscopy".
Letters in Peptide Science 6: 199-207. Abstract: alpha-Conotoxin EI is an 18-residue peptide (RDOCCYHPTCNMSNPQIC;410, 518) isolated from the venom of Conus ermineus, the only fish-hunting cone snail of the Atlantic Ocean. This peptide targets specifically the nicotinic acetylcholine receptor (nAChR) found in mammalian skeletal muscle and the electric organ Torpedo, showing a novel selectivity profile when compared to other alpha-conotoxins. The 3D structure of EI has been determined by 2D-NMR methods in combination with dynamical simulated annealing protocols. A total of 133 NOE-derived distances were used to produce 13 structures with minimum energy that complied with the NOE restraints. The structure of EI is characterized by a helical loop between Thr^9 and Met^12 that is stabilized by the Cys^4-Cys^10 disulfide bond and turns involving Cys^4-Cys^5 and Asn^14-Pro^15. Other regions of the peptide appear to be flexible. The overall fold of EI is similar to that of other alpha 4/7-conotoxins (PnIA/B, MII, EpI). However, unlike these other alpha 4/7-conotoxins, EI targets the muscular type nAChR. The differences in selectivity can be attributed to differences in the surface charge distribution among these alpha 4/7-conotoxins. The implications for binding of EI to the muscular nAChR are discussed with respect to the current NMR structure of EI.
Luis Gandía, Baldomero Lara , Julita S. Imperial , Mercedes Villarroya , Almudena Albillos , Rosario Maroto , A. G. García , Baldomero M. Olivera . (1997) Analogies and differences between w-conotoxins MVIIC and MVIID binding sites and functions in bovine chromaffin cells. Pflugers Archiv.- Europ J. Pharmacol. 435 55-64.
Key words: Calcium channels, Q channels, Chromaffin cells, w-Conotoxin MVIIC, w-Conotoxin MVIID, 45Ca2+ uptake, Catecholamine release.
[Conus
magus, see JAMA November, 1995, William G. Brose, director of the Pain Clinic at
Stanford university School of Medicine reported on SNX-111, a modified conotoxin with
100-1000 times analgesic potency of morphine and not addictive, useful against severe
pain]
Gatto GJ, Bohme GA, Caldwell WS, Letchworth SR, Traina VM, Obinu MC, Laville M, Reibaud M, Pradier L, Dunbar G, Bencherif M. (2004) TC-1734: an orally active neuronal nicotinic acetylcholine receptor modulator with antidepressant, neuroprotective and long-lasting cognitive effects.CNS Drug Rev.10(2):147-166.
Preclinical Research, Targacept, Inc. 200 East First Street, Suite 300, Winston-Salem, NC 27101-4165, USA.
Abstract: The development of selective ligands targeting neuronal nicotinic acetylcholine receptors to alleviate symptoms associated with neurodegenerative diseases presents the advantage of affecting multiple deficits that are the hallmarks of these pathologies. TC-1734 is an orally active novel neuronal nicotinic agonist with high selectivity for neuronal nicotinic receptors. Microdialysis studies indicate that TC-1734 enhances the release of acetylcholine from the cortex. TC-1734, by either acute or repeated administration, exhibits memory enhancing properties in rats and mice and is neuroprotective following excitotoxic insult in fetal rat brain in cultures and against alterations of synaptic transmission induced by deprivation of glucose and oxygen in hippocampal slices. At submaximal doses, TC-1734 produced additive cognitive effects when used in combination with tacrine or donepezil. Unlike (-)-nicotine, behavioral sensitization does not develop following repeated administration of TC-1734. Its pharmacokinetic (PK) profile (half-life of 2 h) contrasts with the long lasting improvement in working memory (18 h) demonstrating that cognitive improvement extends beyond the lifetime of the compound. The very low acute toxicity of TC-1734 and its receptor activity profile provides additional mechanistic basis for its suggested potential as a clinical candidate. TC-1734 was very well tolerated in acute and chronic oral toxicity studies in mice, rats and dogs. Phase I clinical trials demonstrated TC-1734's favorable pharmacokinetic and safety profile by acute oral administration at doses ranging from 2 to 320 mg. The bioavailability, pharmacological, pharmacokinetic, and safety profile of TC-1734 provides an example of a safe, potent and efficacious neuronal nicotinic modulator that holds promise for the management of the hallmark symptomatologies observed in dementia. Publication Types: Review Review, Tutorial
Gibbs, W.W. (1996) A new way to spell relief: V-e-n-o-m, a toxin
from killer sea snails promises a better painkiller. Scientific American 274: 20-21.
[Abstract: The only thing worse than a pain- filled life is a painful death. Both are altogether too common. The World Health Organization estimates that on any given day over three million people struggle with chronic pain from cancer alone. In the U.S., a study published last November in the Journal of the American Medical Association revealed that of thousands of terminal patients interviewed at five major hospitals, about half spent their final days in agony. The study's authors laid much of the blame at the feet of a medical culture that chases miracles to the bitter end rather than doing its best to assuage suffering.
But there is another reason that medicine so often fails to offer relief: doctors still have few weapons against pain, and each has major drawbacks. Aspirin and other over-the-counter remedies are far too weak for most chronic conditions. Narcotics such as morphine often work for a while, but many patients quickly become physically dependent and require ever stronger infusions. Eventually, says William G. Brose, director of the Pain Clinic at the Stanford University School of Medicine, "opiatetolerant patients feel no effect even from a dose thousands of times stronger than that needed to kill you or me." As a result, many sufferers can obtain comfort only at the cost of their faculties.
Gonor, J.J. 1966. Escape responses of N. Borneo Strombid gastropods elicited by the predatory prosobranchs Aulica vespertilio & Conus marmoreus . Veliger 8 (4) 226-230.
Gouda, H., Yamazaki, K-i., Hasegawa, J., Kobayashi, Y., Nishiuchi, Y., Sakakibara, S. and Hirono, S. (1997) Solution structure of alpha-conotoxin MI determined by (1)H-NMR spectroscopy and molecular dynamics simulation with the explicit solvent water. BBA - Proteins and Proteomics, 1343: 327-334.
Goya P., Jagerovic N., Hernandez-Folgado L. and Martin M.I. (2003) Cannabinoids and Neuropathic Pain.
Mini Reviews in Medicinal Chemistry 3: 765-772
Abstract:This review presents available clinical studies and new insights into mechanisms of analgesic effect and possible new routes of administration of antidepressant drugs. Older TCAs continue to be superior treatments. We focused on recent findings on newer antidepressants as analgesics. Their use should be supported by further controlled trials.
PMID: 14529518 [PubMed - in process]
Gray, W.R., Luque, A., Olivera, B.M., Barrett, J. and Cruz, L.J.
(1981) Peptide toxins from Conus geographus venom. J. Biol. Chem. 256: 4734-4740.
[Abstract:[Conus
geographus, Indo-Pacific, GI, GIA, GII]
Gray, W.R., Rivier, J.E., Galyean, R., Cruz, L.J. and Olivera, B.M.
(1983) Conotoxin MI. Disulfide bonding and conformational states. J. Biol. Chem. 258:
12247-12251.
[Abstract:[Conotoxin MI and GI , selectivity in mice, MI/GI=2.5/1]
- Groebe, D.R., Dumm, J.M., Levitan, E.S., and Abramson, S.N. (1995)
alpha-Conotoxins selectively inhibit one of the two acetylcholine binding sites of
nicotinic receptors. Mol Pharmacol, 48: 105-111.
- [Conus magus, alpha-conotoxin MI, alpha 3/5 group,
Indo-Pacific]
- Abstract
- Muscle subtypes of the nicotinic acetylcholine
receptor contain two acetylcholine binding sites that can be distinguished
pharmacologically. The affinities of several alpha-conotoxins for the two acetylcholine
binding sites on nicotinic receptors from BC3H1 cells and Torpedo electric organ were
investigated. alpha-Conotoxins MI, GI, and SIA each inhibited the binding of
125I-alpha-bungarotoxin to nicotinic acetylcholine receptors on BC3H1 cells with two
distinct and independent affinities, which differed by 10,000-fold. The affinities of
alpha-conotoxins SI and SII were significantly lower and the differences in the affinities
of each of these toxins for the two sites were < 400-fold. alpha-Conotoxins MI, GI,
SIA, and SI had higher affinity for the acetylcholine binding site near the alpha/delta
subunit interface of nicotinic receptors from BC3H1 cells. However, when assessed using
nicotinic receptors from Torpedo electric organ, alpha-conotoxin MI displayed higher
affinity for the acetylcholine binding site near the alpha/gamma subunit interface. These
observations suggest that species variations in the sequences of the gamma and delta
subunits resulted in a dramatic reversal of the relative affinities of the
alpha-conotoxins for each acetylcholine binding site. Some of the practical implications
of these observations are discussed.
HABE & al., 1970. Description of New Subgenus & Species of Latiaxis from
the S. China Sea. 4pp., 3figs., in English & Japanese. Euro 0.65
HABE & al., 1970. Descriptions of 2 N.Sp. of Cone Shell from the
Philippines & Taiwan. 3pp., 1pl., in English & Japanese. Euro 0.70
HABE, 1965. 2 New Cones from Japan. 4pp., 1pl., in Japanese & English.
Euro 0.85
HABE, 1965. Notes on the Ivory Shell Genus Babylonia. 10pp., 1pl.
Euro 1.75
Hamann, G., (1990). In search of Conus hamanni. Hawaiian Shell News, 38 (1): 1 & 5
Hann, R.M., Pagan, O.R., Gregory, L.M., Jacome, T. and Eterovic, V.A
(1997) The 9-arginine residue of a-conotoxin GI is responsible for its selective high
affinity for the ag agonist site on the electric organ acetylcholine receptor. Biochemistry
36: 9051-9056.
Abstract: The agonist-binding domains of the electric organ
nicotinic acetylcholine receptor are located at the ad and ag subunit interfaces.
a-Conotoxins GI (from Conus geographus) and MI (from Conus magus)
are competitive antagonists of this receptor and, like d-tubocurarine, bind to the
ag site with much higher affinity than ot the ad site. In the present study, a-conotoxin
SIA (from Conus striatus) also displayed strong affinity for the ag site but
no measurable affinity tfor the ad site, thus showing even greater site selectivity. In
contrast, a-conotoxin SI does not distinguish between the two agonist sites, although its
sequence differs from that of GI at only three postions: GI, ECCNPACGRHYSC;
SI, ICCNPACGPKYSC. Analogues of SI and GI modified at these three postions
were studied to identify the determinants of GI's ag selectivity. Substituting arginine
for proline at position 9 produced peptides which displayed "GI-like"
selectivity for the ag site. Conversely, substituting proline for arginine at position 9
resulted in "SI-like" nonselective inhibitors. An SI analogue having alanine in
place of proline 9 did not distinguish between the two agonist sites and displayed about
the same affinity as SI, indicating the importance of the arginyl cation. Interchanging
the residues at position 1 or at position 10 influenced the affinity for the receptor but
did no measurably change peptide selectivity. Therefore, of the three sequence differences
in SI and GI, the variation at position 9, proline and arginine, respectively, is
sufficident to account for GI's selective high-affinity binding to the ag site on the
electric organ acetylcholine receptor.
HANNA, 1963. W. American mollusks of the genus Conus-2. 91pp.,11col.pls., 4figs., a few underlinings in pencil.
Hart, S.(1997) Cone snail toxins take off; potent neurotoxins stop fish in their tracks - and may provide new pain therapies. (includes related articles on pain treatments based on conotoxins and the relationship between marine animal toxins and sodium channels)BioScience, 47: 131-135..
Abstract: Marine snails called purple cones emit potent neurotoxins through a hollow harpoon, causing instant paralysis in their prey. These same toxins show promise as chronic pain treatment, such as in cancer and AIDS. They target a calcium channel subtype in nerve cells that carry pain impulses.
Hanna & Strong, West American Mollusks of the Genus Conus (76 p., 6 pls)
and two smaller papers by Ingram on Cypraeidae; All bound together in cloth. Library stamps. All published in
Proceedings of the California Academy of Sciences. MG03293 € 36,00
Harvey, A.,(2002) Toxins 'R' Us: more pharmacological tools from nature's superstore.Trends Pharmacol Sci. 23:201-203.
Abstract: Conus venoms from marine cone snails continue to provide novel bioactive components. Two new classes of conopeptide specifically block alpha(1)-adrenoceptors (rho-conopeptide) and noradrenaline transporters (chi-conopeptides). Both classes are small peptides with two disulfide bonds. Rho-conopeptide is structurally similar to alpha-conotoxins, which block nicotinic acetylcholine receptors, whereas the chi-conopeptides are unrelated to other conotoxins. Both types of conopeptides are non-competitive blockers. Because these peptides demonstrate greater selectivity than current drugs in clinical use, they could lead to the development of improved therapeutics.
Harvey, S.C., McIntosh, J.M., Cartier, G.E., Maddox, F.N. and
Luetje, C.W. (1997) Determinants of specificity for alpha-conotoxin MII on alpha3/beta2
neuronal nicotinic receptors. Molecular Pharmacology 51: 336-342.
Abstract: Conus magus, alpha-conotoxin MII, 16aa peptide,
blocks neuronal nAChRs composed of a3b2 subunits. Identified residues on the a and b
subunits of neuronal nAChRs that determine sensitivity to a-CTX MII. Screened series of a
and b subunit chimeras to identify critical sequence segments. Then used site-directed
mutagenesis to identify individual residues important in determination of a-CTX MII
sensitivity of the a3b2 subunit combination. Results: for a3 subunit, sequence
segments 121-181 and 181-195 were the determinants of sensitivity and Lys185 and Ile 188
are the critical residues. For b2 subunit, segment 54-63 is important for sensitivity and
Thr 59 is an important residue. The only mutation that had an effect on sensitivity was b2
T59K. These receptors were significantly (4-fold) less sensitive to MII. MII block was not
affected by introducing a negative charge (Asp = D) at residue 59 of b2 (T59D). The b2
T59D mutation had no effect on a-CTX MII sensitivity; see also Cartier et al., 1997
below]
Hashimoto, K., Uchida, S., Yoshida, H., Nishiuchi, Y., Sakakibara,
S. and Yukari, K. (1985) Structure-activity relations of conotoxins at the neuromuscular
junction. Eur. J. Pharmac. 118: 351-354.
[Abstract: Conotoxin GI and MI, GI is 2.5 times more
potent than MI, selectivity for neuromuscular system, neostigmine reverses]
Hasson, A, Fainzilber, M, Gordon, D, Zlotkin, E, Spira, M E. (1993).
Alteration of Sodium Currents by New Peptide Toxins from the Venom of A Molluscivorous
Conus Snail. EUR J NEUROSCI 5 1 1993 EJONE European Journal of Neuroscience 0953-816X
56-64.
R.E.W. Hatley. (2002) Marine mollusks and the skin. Dermatologic Therapy 15: 38-43.
Abstract: Human contact with marine mollusks such as shellfish, marine snails, octopuses, and squids may result in human illness including dermatologic disorders. These range from minor traumatic injury of the skin to more serious systemic illnesses that include dermatologic manifestations. Notable among these are dermatologic manifestations of illness caused by toxins from ingested mollusks, stings of the cone snail, and envenomation by the bite of the blue-ringed octopus. Cone snail and blue-ringed octopus envenomations, although rare, can be deadly due to neuromuscular paralysis. Management of dermatologic illnesses caused by marine mollusks depends upon the nature of the exposure. Attention to local measures is usually sufficient for minor cuts and abrasions. Conversely, cone snail and blue-ringed octopus envenomations require immediate attention, possibly including cardiopulmonary resuscitation.
Haubrich, C., Frielingsdorf, V., Herzig, S., Schroder, H., Schwarting, R., Sturm, V. and Voges, J. (2000) N-type calcium channel blockers - tools for modulation of cerebral functional units ?. Brain Res. 855: 225 - 234
Hawdon GM, Winkel KD. (1997) Venomous marine creatures.Aust Fam Physician. 26: 1369-1374.
Australian Venom Research Unit, Cabrini Private Hospital.
BACKGROUND: Many venomous marine creatures inhabit Australian waters, causing significant morbidity and occasional fatalities. No antivenom is available for most of these creatures. Little is known about the venom or syndromes produced by many of these creatures. OBJECTIVE: This article discusses the features of envenomation by some of the more commonly encountered venomous marine creatures, and the recommended first aid and medical management of such envenomations. DISCUSSION: The information contained within this article is intended to provide the reader with an overview of some of the more common marine envenomations, and hopefully with the knowledge to effectively manage such problems.
Comment in: Aust Fam Physician. 1998 May;27(5):343-4. Aust Fam Physician. 1998 May;27(5):344.
Heading, C.E., 1999. Ziconotide, Neurex Corp. Current Opinion in CPNS Investigational Drugs 1, 153-166.
Heading, C.E., 2001. Ziconotide (Elan Pharmaceuticals). IDrugs 4, 339-350.
Heading, C.E., 2002. Conus peptides and neuroprotection. Curr Opin Investig Drugs 3, 915-920.
Heiman, E.L.., ( 2002) Shells of East Sinai, an illustrated list. Conidae. Triton, 5: 19-23.
Heiman, E.L., (2002) Shells of East Sinai an illustrated list. Conidae. Triton, Supplement 1: 1-10.
Hill, J.M., Atkins, A.R., Loughnan, M.L., Jones, A., Adams, D.A., Martin, R.C., Lewis, R.J., Craik, D.J. and Alewood, P.F. (2000)Conotoxin TVIIA, a novel peptide from the venom of Conus tulipa: 1. Isolation, characterization and chemical synthesis. Europ. J. Biochem. 267: 4642-4649..
Abstract: A novel conotoxin belonging to the `four-loop' structural class has been isolated from the venom of the piscivorous cone snail Conus tulipa. It was identified using a chemical-directed strategy based largely on mass spectrometric techniques. The new toxin, conotoxin TVIIA, consists of 30 amino-acid residues and contains three disulfide bonds. The amino-acid sequence was determined by Edman analysis as SCSGRDSRCOOVCCMGLMCSRGKCVSIYGE where O = 4-transl-hydroxyproline. Two under-hydroxylated analogues, Pro10TVIIA and Pro10,11TVIIA, were also identified in the venom of C. tulipa. The sequences of TVIIA and Pro10TVIIA were further verified by chemical synthesis and coelution studies with native material. Conotoxin TVIIA has a six cysteine four-loop structural framework common to many peptides from Conus venoms including the omega-, delta- and kappa-conotoxins. However, TVIIA displays little sequence homology with these well-characterized pharmacological classes of peptides, but displays striking sequence homology with conotoxin GS, a peptide from Conus geographus that blocks skeletal muscle sodium channels. These new toxins and GS share several biochemical features and represent a distinct subgroup of the four-loop conotoxins.
Hill, J.M., Alewood, P.F. and Craik, D.J.(2000) Conotoxin TVIIA, a novel peptide from the venom of Conus tulipa : 2. Three-dimensional solution structure. Europ J Biochem. 267: 4649-4658. .
Abstract: The three-dimensional solution structure of conotoxin TVIIA, a 30-residue polypeptide from the venom of the piscivorous cone snail Conus tulipa, has been determined using 2D 1H NMR spectroscopy.TVIIA contains six cysteine residues which form a `four-loop' structural framework common to many peptides from Conus venoms including the omega-, delta-, kappa-, and O-conotoxins. However, TVIIA does not belong to these well-characterized pharmacological classes of conotoxins, but displays high sequence identity with conotoxin GS, a muscle sodium channel blocker from Conus geographus. Structure calculations were based on 562 interproton distance restraints inferred from NOE data, together with 18 backbone and nine side-chain torsion angle restraints derived from spin-spin coupling constants. The final family of 20 structures had mean pairwise rms differences over residues 2-27 of 0.18 +- 0.05 A for the backbone atoms and 1.39 +- 0.33 A for all heavy atoms. The structure consists of a triple-stranded, antiparallel beta sheet with +2x, 1 topology (residues 7-9, 16-20 and 23-27) and several beta turns. The core of the molecule is formed by three disulfide bonds which form a cystine knot motif common to many toxic and inhibitory polypeptides. The global fold, molecular shape and distribution of amino-acid sidechains in TVIIA is similar to that previously reported for conotoxin GS, and comparison with other four-loop conotoxin structures provides further indication that TVIIA and GS represent a new and distinct subgroup of this structural family. The structure of TVIIA determined in this study provides the basis for determining a structure-activity relationship for these molecules and their interaction with target receptors.
Hill, J.M., Oomen, C.J., Miranda, L.P., Bingham, J.-P., Alewood, P.F. and Craik, D.J. (1998)
Three-Dimensional Solution Structure of a-Conotoxin MII by NMR Spectroscopy:
Effects of Solution Environment on Helicity. Biochemistry 37 15621-15630.
Hinegardner, R.T. (1958) The venom apparatus of the cone shell. Hawaii Medical Journal 17: 533-563.
Hogg, R.C. and Bertrand, D. (2004) Nicotinic acetylcholine receptors as drug targets. Curr Drug Targets CNS Neurol Disord. 3:123-130.
Department of Physiology, CMU, 1 rue Michel Servet, CH-1211 Geneva 4, Switzerland. hogg1@etu.unige.ch
Abstract: While it has long been documented that nicotine contained in tobacco leaves gives rise to major public health problems it has also been observed that this alkaloid can have beneficial effects. However, it is only with the identification of a family of genes coding for the neuronal nicotinic acetylcholine receptors and increased knowledge of their expression and function in the central nervous system that these receptors have received attention concerning their potential as drug targets. In light of the latest findings about nicotinic acetylcholine receptors and their involvement in disease states we review the possibility to design new drugs targeted to these ligand-gated channels. Beneficial and possible undesirable actions of agonists, antagonists and allosteric modulators are discussed and placed in perspective of our most recent knowledge.
Hopkins, C., Grilley, M., Miller, C., Shon, K.-J., Cruz, L.J., Gray,
W.R., Dykert, J., Rivier, J., Yoshikami, D. and Olivera, B.M. (1995) A new family of Conus
peptides targeted to the nicotinic acetylcholine receptor. J. Biol. Chem. 270:
22361-22367.
[Conus purpurascens, the purple cone, alphaA-conotoxin
PIVA, Gulf of California - eastern Pacific]
Abstract
In this work, a new family of Conus peptides, the
alpha A-conotoxins, which target the nicotinic acetylcholine receptor, is defined. The
first members of this family have been characterized from the eastern Pacific species,
Conus purpurascens (the purple cone)., three peptides that cause paralysis in fish were
purified and characterized from milked venom. The sequence and disulfide bonding pattern
of one of these, alpha A-conotoxin PIVA, is as follows: [formula: see text] where O
represents trans-4-hydroxyproline. The two other peptides purified from C. purpurascens
venom are the under-hydroxylated derivatives, [Pro13]alpha A-conotoxin PIVA and
[Pro7,13]alpha A-conotoxin PIVA. The peptides have been chemically synthesized in a
biologically active form. Both electrophysiological experiments and competition binding
with alpha-bungarotoxin demonstrate that alpha A-PIVA acts as an antagonist of the
nicotinic acetylcholine receptor at the postsynaptic membrane.
Hori, S., Okutani, T. (1996). A New Pyramidellid Gastropod
Ectoparasitic on Conus. Venus, Japanese J. Malacology 55(1):7-14. {Coneodostomia okamurai,
Boonea okamurai n.spp., RhizoConus, VirroConus}
HÖRNES & al., 1851. Die fossilen Mollusken Des Tertiaer-Beckens von Wien. -
No 1. Conus. 42pp., 5pls.,
Hovda, D.A., Fu, K., Badie, H., Samii, A., Pinanong, P. and Becker,
D.P. (1994) Administration of an omega-conopeptide one hour following traumatic brain
injury reduces 45calcium accumulation. Acta Neurochir Suppl (Wien) 60: 521-523. [SNX-111,
NIH 95067173]
Huang, C.-C., Lyu, P.-C., Lin, C.-H. and Hsu, K.-S. (1997) Conantokin-T selectively antagonizes N-methyl-d-aspartate-evoked responses in rat hippocampal slice.Toxicon, 35: 355-364. .
Abstract: This study investigated the mode of action of conantokin-T, a 21 amino acid peptide toxin isolated from the venom of the fish-hunting cone snail Conus tulipa, on excitatory synaptic transmission in rat hippocampal slices using intracellular recording techniques. Superfusion of conantokin-T (1-500 nM) specifically and irreversibly decreased the pharmacologically isolated N-methyl-d-aspartate receptor (NMDA)-mediated excitatory postsynaptic potential (EPSPNMDA) in a concentration-dependent manner but had no effect on normal excitatory synaptic transmission (EPSP). The sensitivity of postsynaptic neurons to NMDA but not to alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid was also antagonized by conantokin-T pretreatment. In addition, the conantokin-T-induced depression of EPSPNMDA could be antagonized by prior treatment of hippocampal slices with eitherdl-2-amino-5-phosphonovaleate (10 muM) or ifenprodil (20 muM). However, 7-chlorokynurenic acid (1 muM) had no effect on the action of conantokin-T. These findings indicated that conantokin-T modulates the NMDA receptor by an interaction with its glutamate binding site and polyamine recognition site.
Humblet, C., Narasimhan, L. and Singh, J. (1995)Snail and spider toxins share similar tertiary structure and 'cystine
motif'Toxicon, 33: 270. .
Abstract: The multi-disulphide bridged peptide toxins, omega-conotoxin GVIA from the venom of the cone snail, Conus geographus, and omega-agatoxins IVA and IVB from the venom of the funnel-web spider Agelenopsis aperta, have become-valuable tools for studying the physiology, pharmacology and anatomical distribution of neuronal voltage-sensitive calcium channels. A comparison of the structures of omega-conotoxin GVIA and omega-agatoxin IVB will be presented with particular focus on the structural role of their disulphides. Despite the difference in size, these toxins have a similar location and disulphide connectivity of half-cystines. The tertiary structures of the two toxins show remarkable similarity. Both toxins fold into a triple-stranded beta-sheet with a +2x, - 1 topology. A sequence alignment indicates a 27% sequence identity, most of which (23%) is accounted for by the half-cystines. The low level of identity between residues other than half-cystines suggests that the structural similarity observed is prominently dictated by the relationship between their cystine motifs. Toxins from snail venoms have been shown to present a common cystine pattern despite very low primary sequence homology. Interestingly, the example presented here shows that similar cystine motifs are found in toxins that originate from different animal species. The structural similarity, in relation to the similar cystine motifs, might imply a common tertiary structure for toxins that share this core. On that basis, the present observation provides a rationale for model-building of toxins which possess a similar cystine motif.
Ibanez-Tallon I, Wen H, Miwa JM, Xing J, Tekinay AB, Ono F, Brehm P, Heintz N. (2004) Tethering naturally occurring Peptide toxins for cell-autonomous modulation of ion channels and receptors in vivo. Neuron. 43:305-311.
Howard Hughes Medical Institute, Laboratory of Molecular Biology, The Rockefeller University, New York, NY 10021 USA.
Abstract: The physiologies of cells depend on electrochemical signals carried by ion channels and receptors. Venomous animals produce an enormous variety of peptide toxins with high affinity for specific ion channels and receptors. The mammalian prototoxin lynx1 shares with alpha-bungarotoxin the ability to bind and modulate nicotin |